Diaphorina citri psyllid: psy18108


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MAEDASAEATLALFGQMKSNNELKTENPEHLKQFEKFIRDFSKSYPTKEEVAKRFAVFEDNLKLIEDLNKGEHGTATYGINHLSDLTREEMKSRLGLNLSKH
cccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEcccccccccHHHHHHHHccccccc
********ATLALFGQM*************LKQFEKFIRDFSKSYPTKEEVAKRFAVFEDNLKLIEDLNKGEHGTATYGINHLSDLTREEMKS**GL*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEDASAEATLALFGQMKSNNELKTENPEHLKQFEKFIRDFSKSYPTKEEVAKRFAVFEDNLKLIEDLNKGEHGTATYGINHLSDLTREEMKSRLGLNLSKH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007614 [BP]short-term memoryprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007613, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0004869 [MF]cysteine-type endopeptidase inhibitor activityprobableGO:0004866, GO:0030234, GO:0061134, GO:0003674, GO:0030414, GO:0004857, GO:0061135

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F75, chain P
Confidence level:very confident
Coverage over the Query: 25-99
View the alignment between query and template
View the model in PyMOL