Diaphorina citri psyllid: psy18112


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MSSYDIEMRIATGASMSRVTYQAPGERNFHIFYQLLVGADVHLLRVVNMAEPMRFRFGRLQHTCYTVATTSVDTIFPSSRRDYDPTDEPLREEDRIWFREELGKLNR
cccccccccccccccccEEEccccccccHHHHHHHcccccHHHHHHcccccccccHHcccccccEEEcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcc
*SSYDIEMRIATGASMSRVTYQAPGERNFHIFYQLLVGADVHLLRVVNMAEPMRFRFGRLQHTCYTVATTSVDTIFPSSRRDYDPTDEPLREEDRIWFREELGKLN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSYDIEMRIATGASMSRVTYQAPGERNFHIFYQLLVGADVHLLRVVNMAEPMRFRFGRLQHTCYTVATTSVDTIFPSSRRDYDPTDEPLREEDRIWFREELGKLNR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Myosin IB heavy chain Myosin is a protein that binds to actin and has ATPase activity that is activated by actin. Myosin IB may have a role in chemotaxis and aggregation; it could serve to stabilize and even retract cortical structures, such as pseudopods and lamellopods. Involved in the whole cell motility of aggregation-stages cells. Overexpression results in significant decrease in the rate of cellular translocation and fluid-phase pinocytosis and abnormalities in the normal rearrangement of the actin cytoskeleton.confidentP34092

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031252 [CC]cell leading edgeprobableGO:0005575, GO:0044464, GO:0005623
GO:0030670 [CC]phagocytic vesicle membraneprobableGO:0030139, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0030666, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0030659, GO:0045335, GO:0012505, GO:0012506, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0042641 [CC]actomyosinprobableGO:0005856, GO:0005575, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043226, GO:0044422
GO:0033275 [BP]actin-myosin filament slidingprobableGO:0030029, GO:0009987, GO:0006928, GO:0030048, GO:0044763, GO:0008150, GO:0070252, GO:0044699
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0032031 [MF]myosin I head/neck bindingprobableGO:0032036, GO:0032037, GO:0008092, GO:0017024, GO:0032028, GO:0017022, GO:0003674, GO:0005488, GO:0005515
GO:0097203 [CC]phagocytic cup lipprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0001891
GO:0000146 [MF]microfilament motor activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0003774
GO:0030898 [MF]actin-dependent ATPase activityprobableGO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0016461 [CC]unconventional myosin complexprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0016459, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W9I, chain A
Confidence level:very confident
Coverage over the Query: 1-106
View the alignment between query and template
View the model in PyMOL