Diaphorina citri psyllid: psy18121

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MAVLTNMNLTSQSQVHLARSLERILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVIVVYFNITYPGLSMAIRKAQWLIK
cccccccccccccccccccHHHHHHHHHHHcccEEcccccccccccccccccccccEEEEcccccccccccccccccCEEECccEEEEEEEcccccHHHHHHHHHHHHc
***********************ILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVIVVYFNITYPGLSMAIRKAQWLIK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVLTNMNLTSQSQVHLARSLERILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVIVVYFNITYPGLSMAIRKAQWLIK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0032154 [CC]cleavage furrowprobableGO:0005575, GO:0044464, GO:0032153, GO:0032155, GO:0005623
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B8C, chain D
Confidence level:confident
Coverage over the Query: 32-107
View the alignment between query and template
View the model in PyMOL