Psyllid ID: psy18121


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MAVLTNMNLTSQSQVHLARSLERILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVIVVYFNITYPGLSMAIRKAQWLIK
cccccccccccccccccccHHHHHHHHHHHHccEEcccccccccccccccccccccEEEEcccccccccccccccccEEEEEccEEEEEEEcccccHHHHHHHHHHHHc
ccHEEcccccccccHHHHHHHHHHHHHHHHcccEEcccccHHcccccccccccccEEEEEEcccccccHHHcccccccccccHHEEEEEEcccccHHHHHHHHHHHHHc
mavltnmnltsqSQVHLARSLERILEEAHLsgelnlsgrklkdfpnsggkydlsdSVIVVYFSrsgrklkdfpnsggkydlsdSVIVVYFNITYPGLSMAIRKAQWLIK
mavltnmnltsqsqVHLARSLERILEEAHlsgelnlsgrklkdfpnsggkydlsdsVIVVYFSRsgrklkdfpnsggkydlsdSVIVVYFNITYPGLSMAIRKAQWLIK
MAVLTNMNLTSQSQVHLARSLERILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVIVVYFNITYPGLSMAIRKAQWLIK
************************************************GKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVIVVYFNITYPGLSMAIRKAQWLI*
***********************ILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVIVVYFNITYPGLSMAIRKAQWLIK
MAVLTNMNLTSQSQVHLARSLERILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVIVVYFNITYPGLSMAIRKAQWLIK
******M**TSQSQ*HLARSLERILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVIVVYFNITYPGLSMAIRKAQWLIK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVLTNMNLTSQSQVHLARSLERILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVIVVYFNITYPGLSMAIRKAQWLIK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
Q5VUJ6 765 Leucine-rich repeat and c yes N/A 0.366 0.052 0.642 1e-06
Q96II8 777 Leucine-rich repeat and c no N/A 0.357 0.050 0.538 3e-06
Q3UMG5 773 Leucine-rich repeat and c yes N/A 0.366 0.051 0.619 4e-06
Q9Y2L9 728 Leucine-rich repeat and c no N/A 0.376 0.056 0.619 9e-06
Q8BVU0 778 Leucine-rich repeat and c no N/A 0.357 0.050 0.512 9e-06
P62046 709 Leucine-rich repeat and c no N/A 0.376 0.057 0.619 1e-05
Q921G6 680 Leucine-rich repeat and c no N/A 0.348 0.055 0.589 0.0001
O75427 683 Leucine-rich repeat and c no N/A 0.339 0.054 0.605 0.0001
>sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 Back     alignment and function desciption
 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 2/42 (4%)

Query: 16  HLARSLERILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSV 57
           H  RSL+R LEEA  SG L+LSGRKL+DFP SG  YDL+D+ 
Sbjct: 75  HTVRSLDRALEEAGSSGILSLSGRKLRDFPGSG--YDLTDTT 114





Homo sapiens (taxid: 9606)
>sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 Back     alignment and function description
>sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 Back     alignment and function description
>sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 Back     alignment and function description
>sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=2 SV=3 Back     alignment and function description
>sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 Back     alignment and function description
>sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=2 SV=1 Back     alignment and function description
>sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
24202405485 hypothetical protein Phum_PHUM584210 [Pe 0.559 0.717 0.677 7e-14
312375689152 hypothetical protein AND_13841 [Anophele 0.422 0.302 0.760 3e-12
158299038 700 AGAP010012-PA [Anopheles gambiae str. PE 0.394 0.061 0.790 2e-11
32278003662 hypothetical protein SINV_05952 [Solenop 0.532 0.935 0.603 7e-11
380012198 730 PREDICTED: leucine-rich repeat and calpo 0.522 0.078 0.612 2e-10
66500629 758 PREDICTED: leucine-rich repeat and calpo 0.522 0.075 0.612 2e-10
350425067 757 PREDICTED: leucine-rich repeat and calpo 0.467 0.067 0.654 2e-10
340709272 826 PREDICTED: hypothetical protein LOC10064 0.477 0.062 0.642 2e-10
332029861 753 Leucine-rich repeat and calponin-like pr 0.522 0.075 0.612 2e-10
383865043 756 PREDICTED: leucine-rich repeat and calpo 0.660 0.095 0.493 5e-10
>gi|242024054|ref|XP_002432445.1| hypothetical protein Phum_PHUM584210 [Pediculus humanus corporis] gi|212517878|gb|EEB19707.1| hypothetical protein Phum_PHUM584210 [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 81.3 bits (199), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 42/62 (67%), Positives = 49/62 (79%), Gaps = 1/62 (1%)

Query: 14 QVHLARSLERILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVIVVY-FSRSGRKLKDF 72
          Q  L +SLERILEEAHLSGEL LSGRKLKDFP SGGKYDLSD+VI  + +SR+  K  ++
Sbjct: 6  QNQLTKSLERILEEAHLSGELKLSGRKLKDFPKSGGKYDLSDTVIADFNYSRNFDKQCEY 65

Query: 73 PN 74
           N
Sbjct: 66 IN 67




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312375689|gb|EFR23010.1| hypothetical protein AND_13841 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158299038|ref|XP_319156.4| AGAP010012-PA [Anopheles gambiae str. PEST] gi|157014176|gb|EAA13901.4| AGAP010012-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|322780036|gb|EFZ09796.1| hypothetical protein SINV_05952 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|380012198|ref|XP_003690173.1| PREDICTED: leucine-rich repeat and calponin homology domain-containing protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|66500629|ref|XP_392557.2| PREDICTED: leucine-rich repeat and calponin homology domain-containing protein 1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350425067|ref|XP_003494001.1| PREDICTED: leucine-rich repeat and calponin homology domain-containing protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340709272|ref|XP_003393235.1| PREDICTED: hypothetical protein LOC100649436 [Bombus terrestris] Back     alignment and taxonomy information
>gi|332029861|gb|EGI69730.1| Leucine-rich repeat and calponin-like proteiny domain-containing protein 3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383865043|ref|XP_003707985.1| PREDICTED: leucine-rich repeat and calponin homology domain-containing protein 1-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
FB|FBgn0032633 1135 Lrch "Leucine-rich-repeats and 0.477 0.045 0.666 1.8e-10
MGI|MGI:2147870 773 Lrch2 "leucine-rich repeats an 0.357 0.050 0.634 2.6e-06
ZFIN|ZDB-GENE-071004-44 525 zgc:171915 "zgc:171915" [Danio 0.348 0.072 0.605 4.1e-06
UNIPROTKB|Q96II8 777 LRCH3 "Leucine-rich repeat and 0.357 0.050 0.538 1.9e-05
MGI|MGI:2443390 709 Lrch1 "leucine-rich repeats an 0.376 0.057 0.619 3.5e-05
MGI|MGI:1917394 778 Lrch3 "leucine-rich repeats an 0.357 0.050 0.512 3.9e-05
UNIPROTKB|F1MV58 658 LRCH4 "Uncharacterized protein 0.348 0.057 0.589 0.00011
RGD|1306145 686 Lrch4 "leucine-rich repeats an 0.348 0.055 0.589 0.00011
UNIPROTKB|F1RMY1 690 LRCH4 "Uncharacterized protein 0.348 0.055 0.589 0.00012
UNIPROTKB|O75427 683 LRCH4 "Leucine-rich repeat and 0.339 0.054 0.605 0.00015
FB|FBgn0032633 Lrch "Leucine-rich-repeats and calponin homology domain protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 161 (61.7 bits), Expect = 1.8e-10, P = 1.8e-10
 Identities = 36/54 (66%), Positives = 41/54 (75%)

Query:     5 TNMNLTSQSQVHLARSLERILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVI 58
             T+  L S SQ  L RSLERILEEAH SGEL L+ RKLKDFP +G KY L+D+VI
Sbjct:    52 TSSALLSHSQ--LTRSLERILEEAHFSGELILTNRKLKDFPRTGTKYSLTDTVI 103




GO:0007265 "Ras protein signal transduction" evidence=ISS
GO:0005938 "cell cortex" evidence=IDA
GO:0032154 "cleavage furrow" evidence=IDA
MGI|MGI:2147870 Lrch2 "leucine-rich repeats and calponin homology (CH) domain containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-44 zgc:171915 "zgc:171915" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q96II8 LRCH3 "Leucine-rich repeat and calponin homology domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2443390 Lrch1 "leucine-rich repeats and calponin homology (CH) domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:1917394 Lrch3 "leucine-rich repeats and calponin homology (CH) domain containing 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MV58 LRCH4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1306145 Lrch4 "leucine-rich repeats and calponin homology (CH) domain containing 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMY1 LRCH4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O75427 LRCH4 "Leucine-rich repeat and calponin homology domain-containing protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
KOG0532|consensus 722 99.71
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.85
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.8
KOG0472|consensus 565 97.73
KOG4579|consensus177 97.56
KOG0617|consensus 264 97.49
KOG0444|consensus 1255 97.32
PLN03150 623 hypothetical protein; Provisional 96.98
KOG0444|consensus 1255 96.98
KOG0472|consensus 565 96.87
KOG0618|consensus 1081 96.83
PLN03150 623 hypothetical protein; Provisional 96.52
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.41
KOG0532|consensus 722 96.26
KOG0617|consensus 264 96.19
KOG4658|consensus 889 96.16
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.15
KOG4658|consensus 889 96.14
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 96.1
KOG4579|consensus177 95.94
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 95.92
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.92
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 95.6
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.57
PRK15386 426 type III secretion protein GogB; Provisional 95.55
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 95.52
PLN03210 1153 Resistant to P. syringae 6; Provisional 95.37
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 95.31
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 95.06
KOG0618|consensus 1081 94.98
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 94.96
PLN03210 1153 Resistant to P. syringae 6; Provisional 94.91
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 94.8
KOG4237|consensus 498 94.77
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 94.42
KOG1259|consensus 490 90.34
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 89.58
PRK15386 426 type III secretion protein GogB; Provisional 86.28
KOG1259|consensus 490 85.81
KOG4194|consensus 873 82.72
>KOG0532|consensus Back     alignment and domain information
Probab=99.71  E-value=1.1e-18  Score=154.37  Aligned_cols=93  Identities=34%  Similarity=0.531  Sum_probs=86.0

Q ss_pred             CCCCccchhHHHHHHHHHHHHhhhhceeEecCCCCCCCCCCCCCcccCCcEEEeeecCccccccccccccccccccceEE
Q psy18121          7 MNLTSQSQVHLARSLERILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVI   86 (109)
Q Consensus         7 ~~~~~~~~~~~~rslerhLE~A~kTGvL~Ls~rkLkeFP~~~~~~dLsdtlrlDL~S~N~~rl~elP~~I~~F~~LksL~   86 (109)
                      .++.|.....|+|++++.+|+|+.||+|.|+||||||||+.+.+|+|+||+++|| |+|  ||.++|.+.|.|.+|++|+
T Consensus        28 g~~~g~~~~s~trsl~r~leeA~~sg~l~Ls~rrlk~fpr~a~~~~ltdt~~aDl-srN--R~~elp~~~~~f~~Le~li  104 (722)
T KOG0532|consen   28 GSIPGGQTTSYTRSLERALEEAEYSGRLLLSGRRLKEFPRGAASYDLTDTVFADL-SRN--RFSELPEEACAFVSLESLI  104 (722)
T ss_pred             CCCCCCCCcccchhhhHHHHHHhhhcccccccchhhcCCCccccccccchhhhhc-ccc--ccccCchHHHHHHHHHHHH
Confidence            3444456678999999999999999999999999999999988899999999999 999  9999999999999999999


Q ss_pred             ecc-eeeccCchhhhhh
Q psy18121         87 VVY-FNITYPGLSMAIR  102 (109)
Q Consensus        87 ~~~-~l~~~P~~~g~l~  102 (109)
                      +.- ++-++|+.++.+.
T Consensus       105 Ly~n~~r~ip~~i~~L~  121 (722)
T KOG0532|consen  105 LYHNCIRTIPEAICNLE  121 (722)
T ss_pred             HHhccceecchhhhhhh
Confidence            988 9999999998775



>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 98.47
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.22
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.18
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 98.15
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.15
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.13
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.1
1w8a_A 192 SLIT protein; signaling protein, secreted protein, 98.09
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.03
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 98.01
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.99
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.96
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 97.96
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.92
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.81
3m19_A251 Variable lymphocyte receptor A diversity region; a 97.79
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 97.78
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 97.78
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.78
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.77
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.77
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.76
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.76
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.75
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.75
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 97.75
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.74
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.74
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 97.74
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.74
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 97.73
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 97.73
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 97.73
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 97.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.68
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.67
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 97.67
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.64
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.62
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 97.59
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 97.59
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 97.59
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.58
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 97.57
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.57
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 97.57
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.57
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.53
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 97.52
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.52
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 97.5
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 97.5
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 97.49
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 97.49
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.49
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 97.49
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 97.47
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.46
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 97.46
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.46
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 97.46
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 97.45
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 97.45
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 97.44
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 97.44
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 97.43
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 97.42
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.42
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 97.42
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 97.41
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 97.41
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 97.39
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.37
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.36
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 97.35
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 97.34
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 97.34
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 97.33
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 97.31
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 97.3
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 97.3
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 97.29
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.29
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 97.28
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 97.26
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 97.25
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 97.24
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.24
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 97.23
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.23
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 97.2
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.2
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 97.2
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 97.19
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 97.16
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.14
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 97.14
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 97.13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 97.12
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 97.12
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 97.12
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 97.1
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 97.08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 97.08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 97.04
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 97.04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 97.02
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 96.97
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.95
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 96.94
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 96.92
4ezg_A197 Putative uncharacterized protein; internalin-A, le 96.89
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 96.86
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 96.85
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 96.83
1o6v_A 466 Internalin A; bacterial infection, extracellular r 96.77
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 96.76
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 96.75
1o6v_A 466 Internalin A; bacterial infection, extracellular r 96.72
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 96.71
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 96.57
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 96.5
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 96.5
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 96.45
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 96.34
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 95.92
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 95.4
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 94.98
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 93.33
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 93.3
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 92.82
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 92.65
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 92.42
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 92.15
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 90.33
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 85.59
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 84.25
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 83.1
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
Probab=98.47  E-value=3.5e-07  Score=69.48  Aligned_cols=84  Identities=18%  Similarity=0.314  Sum_probs=69.3

Q ss_pred             HHHHHHHHHhhhhc--eeEecCCCCCCCCCCCCCcccCCcEEEeeecCccccccccccccccccccceEEecc-eeeccC
Q psy18121         19 RSLERILEEAHLSG--ELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVIVVY-FNITYP   95 (109)
Q Consensus        19 rslerhLE~A~kTG--vL~Ls~rkLkeFP~~~~~~dLsdtlrlDL~S~N~~rl~elP~~I~~F~~LksL~~~~-~l~~~P   95 (109)
                      +.+...++.+..++  +|.|+++++.++|..+  ..+..-..+|| +.|  +|+++|..++++..|+.|++++ .+..+|
T Consensus        69 ~~~~~~l~~~~~~~l~~L~L~~n~l~~lp~~l--~~l~~L~~L~L-~~n--~l~~lp~~~~~l~~L~~L~Ls~n~l~~lp  143 (328)
T 4fcg_A           69 KATADLLEDATQPGRVALELRSVPLPQFPDQA--FRLSHLQHMTI-DAA--GLMELPDTMQQFAGLETLTLARNPLRALP  143 (328)
T ss_dssp             HHHHHHHHHHTSTTCCEEEEESSCCSSCCSCG--GGGTTCSEEEE-ESS--CCCCCCSCGGGGTTCSEEEEESCCCCCCC
T ss_pred             hhhHHHHhcccccceeEEEccCCCchhcChhh--hhCCCCCEEEC-CCC--CccchhHHHhccCCCCEEECCCCccccCc
Confidence            45556677775555  6899999999999988  55765555999 888  9999999999999999999999 888999


Q ss_pred             chhhhhhhhhhc
Q psy18121         96 GLSMAIRKAQWL  107 (109)
Q Consensus        96 ~~~g~l~K~~~~  107 (109)
                      +.++.+.+-+.|
T Consensus       144 ~~l~~l~~L~~L  155 (328)
T 4fcg_A          144 ASIASLNRLREL  155 (328)
T ss_dssp             GGGGGCTTCCEE
T ss_pred             HHHhcCcCCCEE
Confidence            999888765543



>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.45
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.08
d1p9ag_266 von Willebrand factor binding domain of glycoprote 97.91
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.83
d1xkua_ 305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.75
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.74
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 97.71
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.68
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 97.66
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 97.61
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 97.57
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.47
d1ozna_ 284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 97.46
d1w8aa_ 192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.44
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 97.41
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.35
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.32
d1xwdc1 242 Follicle-stimulating hormone receptor {Human (Homo 97.23
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.15
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 96.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 96.95
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.93
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.84
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.83
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.82
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 96.78
d1ozna_ 284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 96.71
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 96.52
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 96.37
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 96.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 94.23
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 92.46
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=98.45  E-value=8.1e-08  Score=63.72  Aligned_cols=59  Identities=14%  Similarity=0.115  Sum_probs=30.3

Q ss_pred             ceeEecCCCCCCCCCCCCCcccCCcEEEeeecCccccccccccccccccccceEEecc-eeeccCc
Q psy18121         32 GELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVIVVY-FNITYPG   96 (109)
Q Consensus        32 GvL~Ls~rkLkeFP~~~~~~dLsdtlrlDL~S~N~~rl~elP~~I~~F~~LksL~~~~-~l~~~P~   96 (109)
                      -.|.|++++++++|..+  ..+..-..+|+ +.|  +|+++|. ++.+..|++|++++ ++..+|+
T Consensus        23 ~~L~ls~N~l~~lp~~~--~~l~~L~~L~l-~~N--~i~~l~~-~~~l~~L~~L~l~~N~i~~~~~   82 (124)
T d1dcea3          23 THLDLSHNRLRALPPAL--AALRCLEVLQA-SDN--ALENVDG-VANLPRLQELLLCNNRLQQSAA   82 (124)
T ss_dssp             CEEECCSSCCCCCCGGG--GGCTTCCEEEC-CSS--CCCCCGG-GTTCSSCCEEECCSSCCCSSST
T ss_pred             CEEECCCCccCcchhhh--hhhhccccccc-ccc--cccccCc-cccccccCeEECCCCccCCCCC
Confidence            34555555555555544  22333222555 555  5555553 55555555555555 5555543



>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure