Psyllid ID: psy18121
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 109 | ||||||
| 242024054 | 85 | hypothetical protein Phum_PHUM584210 [Pe | 0.559 | 0.717 | 0.677 | 7e-14 | |
| 312375689 | 152 | hypothetical protein AND_13841 [Anophele | 0.422 | 0.302 | 0.760 | 3e-12 | |
| 158299038 | 700 | AGAP010012-PA [Anopheles gambiae str. PE | 0.394 | 0.061 | 0.790 | 2e-11 | |
| 322780036 | 62 | hypothetical protein SINV_05952 [Solenop | 0.532 | 0.935 | 0.603 | 7e-11 | |
| 380012198 | 730 | PREDICTED: leucine-rich repeat and calpo | 0.522 | 0.078 | 0.612 | 2e-10 | |
| 66500629 | 758 | PREDICTED: leucine-rich repeat and calpo | 0.522 | 0.075 | 0.612 | 2e-10 | |
| 350425067 | 757 | PREDICTED: leucine-rich repeat and calpo | 0.467 | 0.067 | 0.654 | 2e-10 | |
| 340709272 | 826 | PREDICTED: hypothetical protein LOC10064 | 0.477 | 0.062 | 0.642 | 2e-10 | |
| 332029861 | 753 | Leucine-rich repeat and calponin-like pr | 0.522 | 0.075 | 0.612 | 2e-10 | |
| 383865043 | 756 | PREDICTED: leucine-rich repeat and calpo | 0.660 | 0.095 | 0.493 | 5e-10 |
| >gi|242024054|ref|XP_002432445.1| hypothetical protein Phum_PHUM584210 [Pediculus humanus corporis] gi|212517878|gb|EEB19707.1| hypothetical protein Phum_PHUM584210 [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 81.3 bits (199), Expect = 7e-14, Method: Compositional matrix adjust.
Identities = 42/62 (67%), Positives = 49/62 (79%), Gaps = 1/62 (1%)
Query: 14 QVHLARSLERILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVIVVY-FSRSGRKLKDF 72
Q L +SLERILEEAHLSGEL LSGRKLKDFP SGGKYDLSD+VI + +SR+ K ++
Sbjct: 6 QNQLTKSLERILEEAHLSGELKLSGRKLKDFPKSGGKYDLSDTVIADFNYSRNFDKQCEY 65
Query: 73 PN 74
N
Sbjct: 66 IN 67
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|312375689|gb|EFR23010.1| hypothetical protein AND_13841 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|158299038|ref|XP_319156.4| AGAP010012-PA [Anopheles gambiae str. PEST] gi|157014176|gb|EAA13901.4| AGAP010012-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|322780036|gb|EFZ09796.1| hypothetical protein SINV_05952 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|380012198|ref|XP_003690173.1| PREDICTED: leucine-rich repeat and calponin homology domain-containing protein 1-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|66500629|ref|XP_392557.2| PREDICTED: leucine-rich repeat and calponin homology domain-containing protein 1-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350425067|ref|XP_003494001.1| PREDICTED: leucine-rich repeat and calponin homology domain-containing protein 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340709272|ref|XP_003393235.1| PREDICTED: hypothetical protein LOC100649436 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|332029861|gb|EGI69730.1| Leucine-rich repeat and calponin-like proteiny domain-containing protein 3 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|383865043|ref|XP_003707985.1| PREDICTED: leucine-rich repeat and calponin homology domain-containing protein 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 109 | ||||||
| FB|FBgn0032633 | 1135 | Lrch "Leucine-rich-repeats and | 0.477 | 0.045 | 0.666 | 1.8e-10 | |
| MGI|MGI:2147870 | 773 | Lrch2 "leucine-rich repeats an | 0.357 | 0.050 | 0.634 | 2.6e-06 | |
| ZFIN|ZDB-GENE-071004-44 | 525 | zgc:171915 "zgc:171915" [Danio | 0.348 | 0.072 | 0.605 | 4.1e-06 | |
| UNIPROTKB|Q96II8 | 777 | LRCH3 "Leucine-rich repeat and | 0.357 | 0.050 | 0.538 | 1.9e-05 | |
| MGI|MGI:2443390 | 709 | Lrch1 "leucine-rich repeats an | 0.376 | 0.057 | 0.619 | 3.5e-05 | |
| MGI|MGI:1917394 | 778 | Lrch3 "leucine-rich repeats an | 0.357 | 0.050 | 0.512 | 3.9e-05 | |
| UNIPROTKB|F1MV58 | 658 | LRCH4 "Uncharacterized protein | 0.348 | 0.057 | 0.589 | 0.00011 | |
| RGD|1306145 | 686 | Lrch4 "leucine-rich repeats an | 0.348 | 0.055 | 0.589 | 0.00011 | |
| UNIPROTKB|F1RMY1 | 690 | LRCH4 "Uncharacterized protein | 0.348 | 0.055 | 0.589 | 0.00012 | |
| UNIPROTKB|O75427 | 683 | LRCH4 "Leucine-rich repeat and | 0.339 | 0.054 | 0.605 | 0.00015 |
| FB|FBgn0032633 Lrch "Leucine-rich-repeats and calponin homology domain protein" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 161 (61.7 bits), Expect = 1.8e-10, P = 1.8e-10
Identities = 36/54 (66%), Positives = 41/54 (75%)
Query: 5 TNMNLTSQSQVHLARSLERILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVI 58
T+ L S SQ L RSLERILEEAH SGEL L+ RKLKDFP +G KY L+D+VI
Sbjct: 52 TSSALLSHSQ--LTRSLERILEEAHFSGELILTNRKLKDFPRTGTKYSLTDTVI 103
|
|
| MGI|MGI:2147870 Lrch2 "leucine-rich repeats and calponin homology (CH) domain containing 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-071004-44 zgc:171915 "zgc:171915" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96II8 LRCH3 "Leucine-rich repeat and calponin homology domain-containing protein 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2443390 Lrch1 "leucine-rich repeats and calponin homology (CH) domain containing 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1917394 Lrch3 "leucine-rich repeats and calponin homology (CH) domain containing 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MV58 LRCH4 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| RGD|1306145 Lrch4 "leucine-rich repeats and calponin homology (CH) domain containing 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RMY1 LRCH4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O75427 LRCH4 "Leucine-rich repeat and calponin homology domain-containing protein 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 109 | |||
| KOG0532|consensus | 722 | 99.71 | ||
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.85 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.8 | |
| KOG0472|consensus | 565 | 97.73 | ||
| KOG4579|consensus | 177 | 97.56 | ||
| KOG0617|consensus | 264 | 97.49 | ||
| KOG0444|consensus | 1255 | 97.32 | ||
| PLN03150 | 623 | hypothetical protein; Provisional | 96.98 | |
| KOG0444|consensus | 1255 | 96.98 | ||
| KOG0472|consensus | 565 | 96.87 | ||
| KOG0618|consensus | 1081 | 96.83 | ||
| PLN03150 | 623 | hypothetical protein; Provisional | 96.52 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.41 | |
| KOG0532|consensus | 722 | 96.26 | ||
| KOG0617|consensus | 264 | 96.19 | ||
| KOG4658|consensus | 889 | 96.16 | ||
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 96.15 | |
| KOG4658|consensus | 889 | 96.14 | ||
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 96.1 | |
| KOG4579|consensus | 177 | 95.94 | ||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 95.92 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 95.92 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 95.6 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.57 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 95.55 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.52 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 95.37 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.31 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 95.06 | |
| KOG0618|consensus | 1081 | 94.98 | ||
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 94.96 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 94.91 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 94.8 | |
| KOG4237|consensus | 498 | 94.77 | ||
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 94.42 | |
| KOG1259|consensus | 490 | 90.34 | ||
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 89.58 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 86.28 | |
| KOG1259|consensus | 490 | 85.81 | ||
| KOG4194|consensus | 873 | 82.72 |
| >KOG0532|consensus | Back alignment and domain information |
|---|
Probab=99.71 E-value=1.1e-18 Score=154.37 Aligned_cols=93 Identities=34% Similarity=0.531 Sum_probs=86.0
Q ss_pred CCCCccchhHHHHHHHHHHHHhhhhceeEecCCCCCCCCCCCCCcccCCcEEEeeecCccccccccccccccccccceEE
Q psy18121 7 MNLTSQSQVHLARSLERILEEAHLSGELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVI 86 (109)
Q Consensus 7 ~~~~~~~~~~~~rslerhLE~A~kTGvL~Ls~rkLkeFP~~~~~~dLsdtlrlDL~S~N~~rl~elP~~I~~F~~LksL~ 86 (109)
.++.|.....|+|++++.+|+|+.||+|.|+||||||||+.+.+|+|+||+++|| |+| ||.++|.+.|.|.+|++|+
T Consensus 28 g~~~g~~~~s~trsl~r~leeA~~sg~l~Ls~rrlk~fpr~a~~~~ltdt~~aDl-srN--R~~elp~~~~~f~~Le~li 104 (722)
T KOG0532|consen 28 GSIPGGQTTSYTRSLERALEEAEYSGRLLLSGRRLKEFPRGAASYDLTDTVFADL-SRN--RFSELPEEACAFVSLESLI 104 (722)
T ss_pred CCCCCCCCcccchhhhHHHHHHhhhcccccccchhhcCCCccccccccchhhhhc-ccc--ccccCchHHHHHHHHHHHH
Confidence 3444456678999999999999999999999999999999988899999999999 999 9999999999999999999
Q ss_pred ecc-eeeccCchhhhhh
Q psy18121 87 VVY-FNITYPGLSMAIR 102 (109)
Q Consensus 87 ~~~-~l~~~P~~~g~l~ 102 (109)
+.- ++-++|+.++.+.
T Consensus 105 Ly~n~~r~ip~~i~~L~ 121 (722)
T KOG0532|consen 105 LYHNCIRTIPEAICNLE 121 (722)
T ss_pred HHhccceecchhhhhhh
Confidence 988 9999999998775
|
|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG0472|consensus | Back alignment and domain information |
|---|
| >KOG4579|consensus | Back alignment and domain information |
|---|
| >KOG0617|consensus | Back alignment and domain information |
|---|
| >KOG0444|consensus | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0444|consensus | Back alignment and domain information |
|---|
| >KOG0472|consensus | Back alignment and domain information |
|---|
| >KOG0618|consensus | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0532|consensus | Back alignment and domain information |
|---|
| >KOG0617|consensus | Back alignment and domain information |
|---|
| >KOG4658|consensus | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4658|consensus | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG4579|consensus | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618|consensus | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4237|consensus | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 109 | |||
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.47 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.22 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.18 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.15 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.15 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.13 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.1 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.09 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.06 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.03 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.01 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.99 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.96 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 97.96 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.92 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.88 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.81 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 97.79 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.78 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.78 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.78 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.78 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.77 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.77 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.76 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.76 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.75 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.75 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.75 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.74 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.74 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 97.74 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.74 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 97.73 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.73 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.73 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 97.7 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.68 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.67 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 97.67 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.64 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.62 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 97.59 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 97.59 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.59 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.58 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.57 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.57 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.57 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.57 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.53 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.52 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.52 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 97.5 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 97.5 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 97.49 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.49 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.49 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.49 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.47 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.46 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 97.46 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 97.46 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.46 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.45 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 97.45 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 97.44 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 97.44 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.43 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.42 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.42 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 97.42 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.41 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 97.41 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 97.39 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.37 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.36 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 97.35 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 97.34 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.34 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.33 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 97.31 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 97.3 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.3 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.29 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.29 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.28 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 97.26 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 97.25 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 97.24 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.24 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 97.23 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.23 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.2 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.2 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 97.2 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.19 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.16 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.14 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 97.14 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 97.13 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 97.12 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.12 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 97.12 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 97.1 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 97.08 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 97.08 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 97.04 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.02 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 96.97 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.95 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 96.94 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 96.92 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 96.89 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 96.86 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 96.85 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 96.83 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 96.77 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 96.76 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 96.75 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 96.72 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 96.71 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 96.57 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 96.5 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 96.5 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 96.45 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 96.34 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 95.92 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 95.4 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 94.98 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 93.33 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 93.3 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 92.82 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 92.65 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 92.42 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 92.15 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 90.33 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 85.59 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 84.25 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 83.1 |
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
Probab=98.47 E-value=3.5e-07 Score=69.48 Aligned_cols=84 Identities=18% Similarity=0.314 Sum_probs=69.3
Q ss_pred HHHHHHHHHhhhhc--eeEecCCCCCCCCCCCCCcccCCcEEEeeecCccccccccccccccccccceEEecc-eeeccC
Q psy18121 19 RSLERILEEAHLSG--ELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVIVVY-FNITYP 95 (109)
Q Consensus 19 rslerhLE~A~kTG--vL~Ls~rkLkeFP~~~~~~dLsdtlrlDL~S~N~~rl~elP~~I~~F~~LksL~~~~-~l~~~P 95 (109)
+.+...++.+..++ +|.|+++++.++|..+ ..+..-..+|| +.| +|+++|..++++..|+.|++++ .+..+|
T Consensus 69 ~~~~~~l~~~~~~~l~~L~L~~n~l~~lp~~l--~~l~~L~~L~L-~~n--~l~~lp~~~~~l~~L~~L~Ls~n~l~~lp 143 (328)
T 4fcg_A 69 KATADLLEDATQPGRVALELRSVPLPQFPDQA--FRLSHLQHMTI-DAA--GLMELPDTMQQFAGLETLTLARNPLRALP 143 (328)
T ss_dssp HHHHHHHHHHTSTTCCEEEEESSCCSSCCSCG--GGGTTCSEEEE-ESS--CCCCCCSCGGGGTTCSEEEEESCCCCCCC
T ss_pred hhhHHHHhcccccceeEEEccCCCchhcChhh--hhCCCCCEEEC-CCC--CccchhHHHhccCCCCEEECCCCccccCc
Confidence 45556677775555 6899999999999988 55765555999 888 9999999999999999999999 888999
Q ss_pred chhhhhhhhhhc
Q psy18121 96 GLSMAIRKAQWL 107 (109)
Q Consensus 96 ~~~g~l~K~~~~ 107 (109)
+.++.+.+-+.|
T Consensus 144 ~~l~~l~~L~~L 155 (328)
T 4fcg_A 144 ASIASLNRLREL 155 (328)
T ss_dssp GGGGGCTTCCEE
T ss_pred HHHhcCcCCCEE
Confidence 999888765543
|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 109 | |||
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.45 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.08 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.91 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.83 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.75 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.74 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 97.71 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.68 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 97.66 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.61 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.57 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.47 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 97.46 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.44 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.41 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 97.35 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.32 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 97.23 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.15 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 96.95 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 96.95 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 96.93 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 96.84 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.83 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 96.82 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.78 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 96.71 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 96.52 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 96.37 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 96.37 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 94.23 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 92.46 |
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain domain: Rab geranylgeranyltransferase alpha-subunit, C-terminal domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=98.45 E-value=8.1e-08 Score=63.72 Aligned_cols=59 Identities=14% Similarity=0.115 Sum_probs=30.3
Q ss_pred ceeEecCCCCCCCCCCCCCcccCCcEEEeeecCccccccccccccccccccceEEecc-eeeccCc
Q psy18121 32 GELNLSGRKLKDFPNSGGKYDLSDSVIVVYFSRSGRKLKDFPNSGGKYDLSDSVIVVY-FNITYPG 96 (109)
Q Consensus 32 GvL~Ls~rkLkeFP~~~~~~dLsdtlrlDL~S~N~~rl~elP~~I~~F~~LksL~~~~-~l~~~P~ 96 (109)
-.|.|++++++++|..+ ..+..-..+|+ +.| +|+++|. ++.+..|++|++++ ++..+|+
T Consensus 23 ~~L~ls~N~l~~lp~~~--~~l~~L~~L~l-~~N--~i~~l~~-~~~l~~L~~L~l~~N~i~~~~~ 82 (124)
T d1dcea3 23 THLDLSHNRLRALPPAL--AALRCLEVLQA-SDN--ALENVDG-VANLPRLQELLLCNNRLQQSAA 82 (124)
T ss_dssp CEEECCSSCCCCCCGGG--GGCTTCCEEEC-CSS--CCCCCGG-GTTCSSCCEEECCSSCCCSSST
T ss_pred CEEECCCCccCcchhhh--hhhhccccccc-ccc--cccccCc-cccccccCeEECCCCccCCCCC
Confidence 34555555555555544 22333222555 555 5555553 55555555555555 5555543
|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|