Diaphorina citri psyllid: psy18155


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
TRNVVAECLGKLTLIDPSNLLPRLQESLKSNSALMRTTPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKKTLIREVEMGPFKHTVDDGLD
cHHHHHHHHHHHHHccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHcHHHHHHHHHHHHHHHHHHcccccEEEECcccccccccccc
*RNVVAECLGKLTLIDPSNLLPRLQESLKS*SA***TTPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKKTLIREVEMGPFKHTVDDG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TRNVVAECLGKLTLIDPSNLLPRLQESLKSNSALMRTTPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKKTLIREVEMGPFKHTVDDGLD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cullin-associated NEDD8-dissociated protein 1 Regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. Prevents neddylation of CUL1 by physically blocking access to the neddylation site. Disrupts interactions between CUL1 and SKP1 and between CUL1 and F-box proteins (By similarity). Enhances transcription from various types of promoters.confidentP97536
Cullin-associated NEDD8-dissociated protein 1 Enhances transcription from various types of promoters. Regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. Prevents neddylation of CUL1 by physically blocking access to the neddylation site. Disrupts interactions between CUL1 and SKP1 and between CUL1 and F-box proteins.confidentA7MBJ5
Cullin-associated NEDD8-dissociated protein 1 Enhances transcription from various types of promoters (By similarity). Regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. Prevents neddylation of CUL1 by physically blocking access to the neddylation site. Disrupts interactions between CUL1 and SKP1 and between CUL1 and F-box proteins.confidentQ86VP6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0031461 [CC]cullin-RING ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0010265 [BP]SCF complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0043623, GO:0071840
GO:0043086 [BP]negative regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0050789
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0017025 [MF]TBP-class protein bindingprobableGO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0045899 [BP]positive regulation of RNA polymerase II transcriptional preinitiation complex assemblyprobableGO:0060260, GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0051173, GO:0031323, GO:0051128, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0044087, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:2000142, GO:0065007, GO:0048518, GO:0010468, GO:0051130, GO:0045935, GO:0010556, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:2001141, GO:0043254, GO:0045898, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0045944, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FDD, chain A
Confidence level:confident
Coverage over the Query: 2-157
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1u6g, chain C very confident Alignment | Template Structure