Psyllid ID: psy18155

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
TRNVVAECLGKLTLIDPSNLLPRLQESLKSNSALMRTTPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKKTLIREVEMGPFKHTVDDGLD
cHHHHHHHHHHHHHccccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHcHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccccccc
cccHHHHHHcHEEEccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHcccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccEEcccccc
TRNVVAECLgkltlidpsnllpRLQESLKsnsalmrttpqsidpLLRQTIGDFLSALKDSDLNVRRVALVAFnsaahnkpsLVIDLLDSVLPQlyaetavkpqsidplLRQTIGDFLSALKDSDLNVRRVALVAFnsaahnkpsLVIDLLDSVLPQLYAETAVKKTLIREVemgpfkhtvddgld
trnvvaeclgkltlidpsnllPRLQESLKSNSALMRttpqsidplLRQTIGDFLSALKDSDLNVRRVALVAfnsaahnkpsLVIDLLDSVLPQLYAETavkpqsidplLRQTIGDFLSALKDSDLNVRRVALVAfnsaahnkpsLVIDLLDSVLPQLYAETAVKKTLIrevemgpfkhtvddgld
TRNVVAECLGKLTLIDPSNLLPRLQESLKSNSALMRTTPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKKTLIREVEMGPFKHTVDDGLD
****VAECLGKLTLIDP**************************PLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKKTLIREVEMG***********
*RNVVAECLGKLTLIDPSNLLPRLQESLKS*SA***TTPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKKTLIREVEMGPFKHTVDDG**
TRNVVAECLGKLTLIDPSNLLPRLQESLKSNSALMRTTPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKKTLIREVEMGPFKHTVDDGLD
TRNVVAECLGKLTLIDPSNLLPRLQESLKSNSALMRTTPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKKTLIREVEMGPFKHTVD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TRNVVAECLGKLTLIDPSNLLPRLQESLKSNSALMRTTPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKKTLIREVEMGPFKHTVDDGLD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query185 2.2.26 [Sep-21-2011]
P97536 1230 Cullin-associated NEDD8-d yes N/A 0.724 0.108 0.529 2e-42
Q6ZQ38 1230 Cullin-associated NEDD8-d yes N/A 0.724 0.108 0.529 2e-42
Q86VP6 1230 Cullin-associated NEDD8-d yes N/A 0.724 0.108 0.524 4e-42
A7MBJ5 1230 Cullin-associated NEDD8-d yes N/A 0.724 0.108 0.524 4e-42
Q5R6L5 1230 Cullin-associated NEDD8-d yes N/A 0.724 0.108 0.524 4e-42
O75155 1236 Cullin-associated NEDD8-d no N/A 0.724 0.108 0.454 4e-29
Q6ZQ73 1235 Cullin-associated NEDD8-d no N/A 0.724 0.108 0.432 7e-28
Q9R0L4 1273 Cullin-associated NEDD8-d no N/A 0.724 0.105 0.432 1e-27
Q86KD1 1238 Cullin-associated NEDD8-d yes N/A 0.724 0.108 0.383 1e-23
Q8L5Y6 1219 Cullin-associated NEDD8-d yes N/A 0.718 0.109 0.358 4e-19
>sp|P97536|CAND1_RAT Cullin-associated NEDD8-dissociated protein 1 OS=Rattus norvegicus GN=Cand1 PE=1 SV=1 Back     alignment and function desciption
 Score =  171 bits (434), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 98/185 (52%), Positives = 107/185 (57%), Gaps = 51/185 (27%)

Query: 1    TRNVVAECLGKLTLIDPSNLLPRLQESLKSNSALMRTTPQSIDPLLRQTIGDFLSALKDS 60
            TRNVVAECLGKLTLIDP  LLPRL+  L S S+  R++                      
Sbjct: 947  TRNVVAECLGKLTLIDPETLLPRLKGYLISGSSYARSSV--------------------- 985

Query: 61   DLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPLLRQTIGDFLSAL 120
                  V  V F  + H                        PQ IDPLL+  IGDFL  L
Sbjct: 986  ------VTAVKFTISDH------------------------PQPIDPLLKNCIGDFLKTL 1015

Query: 121  KDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKKTLIREVEMGPFKHTV 180
            +D DLNVRRVALV FNSAAHNKPSL+ DLLDSVLP LY ET V+K LIREVEMGPFKHTV
Sbjct: 1016 EDPDLNVRRVALVTFNSAAHNKPSLIRDLLDSVLPHLYNETKVRKELIREVEMGPFKHTV 1075

Query: 181  DDGLD 185
            DDGLD
Sbjct: 1076 DDGLD 1080
Regulatory protein that interferes with the assembly of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex and thereby down-regulates ubiquitination of target proteins. Prevents neddylation of CUL1 by physically blocking access to the neddylation site. Disrupts interactions between CUL1 and SKP1 and between CUL1 and F-box proteins (By similarity). Enhances transcription from various types of promoters.
Rattus norvegicus (taxid: 10116)
>sp|Q6ZQ38|CAND1_MOUSE Cullin-associated NEDD8-dissociated protein 1 OS=Mus musculus GN=Cand1 PE=2 SV=2 Back     alignment and function description
>sp|Q86VP6|CAND1_HUMAN Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens GN=CAND1 PE=1 SV=2 Back     alignment and function description
>sp|A7MBJ5|CAND1_BOVIN Cullin-associated NEDD8-dissociated protein 1 OS=Bos taurus GN=CAND1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R6L5|CAND1_PONAB Cullin-associated NEDD8-dissociated protein 1 OS=Pongo abelii GN=CAND1 PE=2 SV=1 Back     alignment and function description
>sp|O75155|CAND2_HUMAN Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens GN=CAND2 PE=1 SV=3 Back     alignment and function description
>sp|Q6ZQ73|CAND2_MOUSE Cullin-associated NEDD8-dissociated protein 2 OS=Mus musculus GN=Cand2 PE=1 SV=2 Back     alignment and function description
>sp|Q9R0L4|CAND2_RAT Cullin-associated NEDD8-dissociated protein 2 OS=Rattus norvegicus GN=Cand2 PE=1 SV=1 Back     alignment and function description
>sp|Q86KD1|CAND1_DICDI Cullin-associated NEDD8-dissociated protein 1 OS=Dictyostelium discoideum GN=cand1 PE=3 SV=1 Back     alignment and function description
>sp|Q8L5Y6|CAND1_ARATH Cullin-associated NEDD8-dissociated protein 1 OS=Arabidopsis thaliana GN=CAND1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
345498168 1236 PREDICTED: cullin-associated NEDD8-disso 0.724 0.108 0.578 3e-46
383861077 1235 PREDICTED: cullin-associated NEDD8-disso 0.724 0.108 0.567 2e-45
242025566 1235 Cullin-associated NEDD8-dissociated prot 0.724 0.108 0.567 2e-45
307178347 1230 Cullin-associated NEDD8-dissociated prot 0.724 0.108 0.562 3e-45
307200142 1238 Cullin-associated NEDD8-dissociated prot 0.724 0.108 0.556 3e-44
66548257 1235 PREDICTED: cullin-associated NEDD8-disso 0.724 0.108 0.556 4e-44
380024286 1235 PREDICTED: LOW QUALITY PROTEIN: cullin-a 0.724 0.108 0.556 4e-44
350423911 1235 PREDICTED: cullin-associated NEDD8-disso 0.724 0.108 0.556 5e-44
332022242 1238 Cullin-associated NEDD8-dissociated prot 0.724 0.108 0.556 5e-44
340726325 1235 PREDICTED: cullin-associated NEDD8-disso 0.724 0.108 0.556 5e-44
>gi|345498168|ref|XP_001606869.2| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 107/185 (57%), Positives = 119/185 (64%), Gaps = 51/185 (27%)

Query: 1    TRNVVAECLGKLTLIDPSNLLPRLQESLKSNSALMRTTPQSIDPLLRQTIGDFLSALKDS 60
            TRNVVAECLGKLTLIDP+NLLPRLQE LKS+SALMRTT  +    ++ TI D        
Sbjct: 950  TRNVVAECLGKLTLIDPANLLPRLQELLKSSSALMRTTTVTA---VKFTISD-------- 998

Query: 61   DLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPLLRQTIGDFLSAL 120
                                                    +PQ IDP+L+Q +G+FL AL
Sbjct: 999  ----------------------------------------QPQPIDPMLKQCMGNFLIAL 1018

Query: 121  KDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKKTLIREVEMGPFKHTV 180
            +D +LNVRRVALVAFNSAAHNKP LV DLLD VLPQLYAET VKK LIREVEMGPFKHTV
Sbjct: 1019 EDPNLNVRRVALVAFNSAAHNKPMLVRDLLDQVLPQLYAETKVKKELIREVEMGPFKHTV 1078

Query: 181  DDGLD 185
            DDGLD
Sbjct: 1079 DDGLD 1083

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383861077|ref|XP_003706013.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|242025566|ref|XP_002433195.1| Cullin-associated NEDD8-dissociated protein, putative [Pediculus humanus corporis] gi|212518736|gb|EEB20457.1| Cullin-associated NEDD8-dissociated protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307178347|gb|EFN67101.1| Cullin-associated NEDD8-dissociated protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307200142|gb|EFN80451.1| Cullin-associated NEDD8-dissociated protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|66548257|ref|XP_393409.2| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380024286|ref|XP_003695932.1| PREDICTED: LOW QUALITY PROTEIN: cullin-associated NEDD8-dissociated protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|350423911|ref|XP_003493628.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332022242|gb|EGI62557.1| Cullin-associated NEDD8-dissociated protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340726325|ref|XP_003401510.1| PREDICTED: cullin-associated NEDD8-dissociated protein 1-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query185
UNIPROTKB|F1NHL21159 CAND1 "Uncharacterized protein 0.681 0.108 0.562 3.3e-30
UNIPROTKB|F1P6241208 CAND1 "Uncharacterized protein 0.681 0.104 0.569 2.8e-30
MGI|MGI:12618201230 Cand1 "cullin associated and n 0.681 0.102 0.569 2.8e-30
RGD|6204791230 Cand1 "cullin-associated and n 0.681 0.102 0.569 2.8e-30
UNIPROTKB|A7MBJ51230 CAND1 "Cullin-associated NEDD8 0.681 0.102 0.562 5.9e-30
UNIPROTKB|Q86VP61230 CAND1 "Cullin-associated NEDD8 0.681 0.102 0.562 5.9e-30
FB|FBgn00275681248 Cand1 "Cullin-associated and n 0.681 0.100 0.534 4e-28
MGI|MGI:1914338 1235 Cand2 "cullin-associated and n 0.459 0.068 0.682 9.1e-29
RGD|620480 1273 Cand2 "cullin-associated and n 0.459 0.066 0.682 1e-28
UNIPROTKB|E1C7411239 CAND2 "Uncharacterized protein 0.681 0.101 0.548 2.4e-28
UNIPROTKB|F1NHL2 CAND1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 346 (126.9 bits), Expect = 3.3e-30, P = 3.3e-30
 Identities = 81/144 (56%), Positives = 98/144 (68%)

Query:     1 TRNVVAECLGKLTLIDPSNLLPRLQESLKSNSALMRTT------------PQSIDPLLRQ 48
             TRNVVAECLGKLTLIDP  LLPRL+  L S S+  R++            PQ IDPLL+ 
Sbjct:   876 TRNVVAECLGKLTLIDPETLLPRLKGYLASGSSYARSSVVTAVKFTISDHPQPIDPLLKN 935

Query:    49 TIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPL 108
              IGDFL  L+D DLNVRRVALV FNSAAHNKPSL+ DLLD+VLP LY ET V+ +    L
Sbjct:   936 CIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLLDTVLPHLYNETKVRKE----L 991

Query:   109 LRQT-IGDFLSALKDSDLNVRRVA 131
             +R+  +G F   + D  L++R+ A
Sbjct:   992 IREVEMGPFKHTVDDG-LDIRKAA 1014
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=ISS
GO:0000151 "ubiquitin ligase complex" evidence=ISS
GO:0005634 "nucleus" evidence=ISS
GO:0016567 "protein ubiquitination" evidence=ISS
GO:0030154 "cell differentiation" evidence=ISS
GO:0043086 "negative regulation of catalytic activity" evidence=ISS
GO:0045899 "positive regulation of RNA polymerase II transcriptional preinitiation complex assembly" evidence=ISS
UNIPROTKB|F1P624 CAND1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1261820 Cand1 "cullin associated and neddylation disassociated 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620479 Cand1 "cullin-associated and neddylation-dissociated 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A7MBJ5 CAND1 "Cullin-associated NEDD8-dissociated protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q86VP6 CAND1 "Cullin-associated NEDD8-dissociated protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0027568 Cand1 "Cullin-associated and neddylation-dissociated 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1914338 Cand2 "cullin-associated and neddylation-dissociated 2 (putative)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620480 Cand2 "cullin-associated and neddylation-dissociated 2 (putative)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C741 CAND2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q86VP6CAND1_HUMANNo assigned EC number0.52430.72430.1089yesN/A
P97536CAND1_RATNo assigned EC number0.52970.72430.1089yesN/A
Q6ZQ38CAND1_MOUSENo assigned EC number0.52970.72430.1089yesN/A
A7MBJ5CAND1_BOVINNo assigned EC number0.52430.72430.1089yesN/A
Q5R6L5CAND1_PONABNo assigned EC number0.52430.72430.1089yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
pfam08623 169 pfam08623, TIP120, TATA-binding protein interactin 5e-16
>gnl|CDD|219941 pfam08623, TIP120, TATA-binding protein interacting (TIP20) Back     alignment and domain information 
 Score = 71.5 bits (176), Expect = 5e-16
 Identities = 28/42 (66%), Positives = 35/42 (83%)

Query: 144 SLVIDLLDSVLPQLYAETAVKKTLIREVEMGPFKHTVDDGLD 185
            L++ LL+ +LP LY+ET VKK LIREV+MGPFKH VDDGL+
Sbjct: 1   DLILPLLNELLPALYSETKVKKELIREVQMGPFKHVVDDGLE 42

TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription. Length = 169

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 185
KOG1824|consensus1233 100.0
KOG2023|consensus 885 99.95
KOG1824|consensus 1233 99.91
PF08623169 TIP120: TATA-binding protein interacting (TIP20); 99.42
KOG2171|consensus 1075 98.46
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 98.09
PRK09687280 putative lyase; Provisional 97.86
KOG2023|consensus 885 97.74
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.73
KOG2171|consensus 1075 97.67
PRK09687280 putative lyase; Provisional 97.65
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.52
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 97.25
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.17
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 97.0
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 96.97
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.92
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 96.71
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 96.66
KOG0915|consensus 1702 96.64
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 96.61
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 96.55
KOG0212|consensus 675 96.5
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 96.41
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 96.33
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 96.09
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 96.09
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 96.05
KOG0915|consensus 1702 95.76
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 95.73
PF08167165 RIX1: rRNA processing/ribosome biogenesis 95.66
KOG0414|consensus 1251 95.64
KOG0166|consensus 514 95.59
PTZ00429 746 beta-adaptin; Provisional 95.57
TIGR02270 410 conserved hypothetical protein. Members are found 95.44
KOG0212|consensus 675 95.4
PTZ00429 746 beta-adaptin; Provisional 95.3
KOG2259|consensus 823 95.23
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 95.14
KOG2160|consensus 342 95.1
KOG1242|consensus 569 94.9
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 94.45
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 94.33
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 93.92
KOG1967|consensus1030 93.66
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 93.41
KOG1058|consensus 948 93.37
KOG1967|consensus1030 93.3
KOG1241|consensus 859 93.12
KOG0166|consensus 514 93.11
KOG1242|consensus 569 92.96
COG5096 757 Vesicle coat complex, various subunits [Intracellu 92.89
KOG2149|consensus 393 92.82
TIGR02270 410 conserved hypothetical protein. Members are found 92.68
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 92.62
PF1036392 DUF2435: Protein of unknown function (DUF2435) 91.99
PF08389148 Xpo1: Exportin 1-like protein; InterPro: IPR013598 91.42
KOG1059|consensus 877 90.78
KOG2025|consensus 892 90.02
KOG0213|consensus 1172 89.95
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 89.85
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 89.64
COG1413335 FOG: HEAT repeat [Energy production and conversion 89.26
KOG0413|consensus 1529 89.25
COG1413335 FOG: HEAT repeat [Energy production and conversion 89.14
KOG1991|consensus 1010 89.03
COG50981128 Chromosome condensation complex Condensin, subunit 88.97
KOG1820|consensus 815 88.35
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 88.21
COG5064 526 SRP1 Karyopherin (importin) alpha [Intracellular t 88.2
COG5096 757 Vesicle coat complex, various subunits [Intracellu 88.13
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 88.05
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 86.24
KOG2259|consensus 823 86.09
KOG1243|consensus 690 85.02
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 84.91
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 84.83
KOG1061|consensus 734 84.15
KOG1020|consensus 1692 83.95
PF12719 298 Cnd3: Nuclear condensing complex subunits, C-term 83.67
KOG1060|consensus 968 83.02
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 82.97
KOG2025|consensus 892 82.88
KOG1248|consensus 1176 82.54
KOG1240|consensus 1431 82.08
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 81.21
KOG1240|consensus 1431 81.19
KOG0946|consensus 970 80.67
KOG1949|consensus 1005 80.24
>KOG1824|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.3e-34  Score=271.25  Aligned_cols=171  Identities=49%  Similarity=0.764  Sum_probs=162.3

Q ss_pred             CchhHHHHHhhcccCCccchHHHHHHhhcCCCcccc------------cchhhhhHHHHhhHHHHHHhccCCChHHHHHH
Q psy18155          1 TRNVVAECLGKLTLIDPSNLLPRLQESLKSNSALMR------------TTPQSIDPLLRQTIGDFLSALKDSDLNVRRVA   68 (185)
Q Consensus         1 ~r~vvae~lg~l~~~~~~~~l~~L~~~l~~~~~~~r------------~~~~~~d~~L~~~i~~fl~~l~d~d~~vR~~a   68 (185)
                      +|||||||||++++.+|..++|+|+..+.|+++..|            |.+.++|.++.+.|.+|+.+++|||++|||+|
T Consensus       948 tR~vvAECLGkL~l~epesLlpkL~~~~~S~a~~~rs~vvsavKfsisd~p~~id~~lk~~ig~fl~~~~dpDl~Vrrva 1027 (1233)
T KOG1824|consen  948 TRNVVAECLGKLVLIEPESLLPKLKLLLRSEASNTRSSVVSAVKFSISDQPQPIDPLLKQQIGDFLKLLRDPDLEVRRVA 1027 (1233)
T ss_pred             hHHHHHHHhhhHHhCChHHHHHHHHHHhcCCCcchhhhhhheeeeeecCCCCccCHHHHHHHHHHHHHHhCCchhHHHHH
Confidence            699999999999999999999999999999998888            88899999999999999999999999999999


Q ss_pred             HHHHHHhhhcCchhhHHhHHhHHHHHHHHhhcCCCCCchHHHhhHHHHHHhccCCCHHHHHHHH----------------
Q psy18155         69 LVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPLLRQTIGDFLSALKDSDLNVRRVAL----------------  132 (185)
Q Consensus        69 l~~ln~~~~~kp~ll~~~l~~~Lp~L~~~t~~~~~~vr~~L~~~m~~~l~~l~D~d~~Vr~~A~----------------  132 (185)
                      |.++|+|+||||+++++.++++||.||.+|++++|+||++   .||||.|.+ |+++++|++|+                
T Consensus      1028 Lvv~nSaahNKpslIrDllpeLLp~Ly~eTkvrkelIreV---eMGPFKH~V-DdgLd~RKaaFEcmytLLdscld~~di 1103 (1233)
T KOG1824|consen 1028 LVVLNSAAHNKPSLIRDLLPELLPLLYSETKVRKELIREV---EMGPFKHTV-DDGLDLRKAAFECMYTLLDSCLDRLDI 1103 (1233)
T ss_pred             HHHHHHHHccCHhHHHHHHHHHHHHHHHhhhhhHhhhhhh---cccCccccc-cchHHHHHHHHHHHHHHHHhhhhhccH
Confidence            9999999999999999999999999999999999999999   999999999 88999999986                


Q ss_pred             ----------------------HHHHHHhhcChhhHHHhHhhHhhhh-------hhhhhhcchhhhhhccCC
Q psy18155        133 ----------------------VAFNSAAHNKPSLVIDLLDSVLPQL-------YAETAVKKTLIREVEMGP  175 (185)
Q Consensus       133 ----------------------~~L~~~a~~~p~lv~~~L~~llp~L-------y~et~vk~el~R~vdmgP  175 (185)
                                            +|+...|...|..|.+.+|+++++|       .++..||||.+|..||+.
T Consensus      1104 t~Fl~~~~~GL~DhydiKmlt~l~l~rLa~lcPs~VlqrlD~l~EpLr~t~~~k~k~~svKqE~ek~~eLkR 1175 (1233)
T KOG1824|consen 1104 TEFLNHVEDGLEDHYDIKMLTFLMLARLADLCPSAVLQRLDRLVEPLRKTCTLKVKANSVKQEFEKQDELKR 1175 (1233)
T ss_pred             HHHHHHHHhhcchhhHHHHHHHHHHHHHHhhCcHHHHHHHHHHHHHHHHHhhcccccchHhHhHHHHHHHHH
Confidence                                  6777888999999999999999999       677889999999999864

>KOG2023|consensus Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>PF08623 TIP120: TATA-binding protein interacting (TIP20); InterPro: IPR013932 TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription [] Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2149|consensus Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG0413|consensus Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG1949|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
1u6g_C 1230 Crystal Structure Of The Cand1-Cul1-Roc1 Complex Le 3e-43
4a0c_A 1253 Structure Of The Cand1-Cul4b-Rbx1 Complex Length = 1e-42
>pdb|1U6G|C Chain C, Crystal Structure Of The Cand1-Cul1-Roc1 Complex Length = 1230 Back     alignment and structure 
Iteration: 1

 Score =  170 bits (431), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 107/185 (57%), Gaps = 51/185 (27%)
Query: 1    TRNVVAECLGKLTLIDPSNLLPRLQESLKSNSALMRTTPQSIDPLLRQTIGDFLSALKDS 60
            TRNVVAECLGKLTLIDP  LLPRL+  L S S+  R++                      
Sbjct: 947  TRNVVAECLGKLTLIDPETLLPRLKGYLISGSSYARSSV--------------------- 985
Query: 61   DLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPLLRQTIGDFLSAL 120
                  V  V F  + H                        PQ IDPLL+  IGDFL  L
Sbjct: 986  ------VTAVKFTISDH------------------------PQPIDPLLKNCIGDFLKTL 1015
Query: 121  KDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKKTLIREVEMGPFKHTV 180
            +D DLNVRRVALV FNSAAHNKPSL+ DLLD+VLP LY ET V+K LIREVEMGPFKHTV
Sbjct: 1016 EDPDLNVRRVALVTFNSAAHNKPSLIRDLLDTVLPHLYNETKVRKELIREVEMGPFKHTV 1075
Query: 181  DDGLD 185
            DDGLD
Sbjct: 1076 DDGLD 1080
>pdb|4A0C|A Chain A, Structure Of The Cand1-Cul4b-Rbx1 Complex Length = 1253 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query185
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 2e-30
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 2e-04
2db0_A253 253AA long hypothetical protein; heat repeats, hel 7e-05
2db0_A253 253AA long hypothetical protein; heat repeats, hel 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 7e-04
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
 Score =  115 bits (288), Expect = 2e-30
 Identities = 79/209 (37%), Positives = 105/209 (50%), Gaps = 24/209 (11%)

Query: 1    TRNVVAECLGKLTLIDPSNLLPRLQESLKSNS------------ALMRTTPQSIDPLLRQ 48
             ++  +  LG +++ +    LP + + + S               +   +   + P +  
Sbjct: 872  VKSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASVVGLKPYVEN 931

Query: 49   TIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQLYAET---------- 98
                 L   + ++   R V            P  ++  L   L    +            
Sbjct: 932  IWALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSSYARSSVVTAVKF 991

Query: 99   --AVKPQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQ 156
              +  PQ IDPLL+  IGDFL  L+D DLNVRRVALV FNSAAHNKPSL+ DLLD+VLP 
Sbjct: 992  TISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLLDTVLPH 1051

Query: 157  LYAETAVKKTLIREVEMGPFKHTVDDGLD 185
            LY ET V+K LIREVEMGPFKHTVDDGLD
Sbjct: 1052 LYNETKVRKELIREVEMGPFKHTVDDGLD 1080
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Length = 240 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
1u6g_C1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.84
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.81
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.25
1ibr_B 462 P95, importin beta-1 subunit, nuclear factor; smal 98.65
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.59
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.51
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.43
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 98.42
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 98.42
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 98.31
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 98.29
1qgr_A 876 Protein (importin beta subunit); transport recepto 98.28
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 98.27
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 98.24
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 98.23
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 98.21
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 98.09
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 98.08
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 98.07
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.07
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 98.05
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 98.04
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 98.03
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.99
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 97.97
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 97.96
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 97.95
1qgr_A 876 Protein (importin beta subunit); transport recepto 97.94
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.89
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 97.87
1ibr_B 462 P95, importin beta-1 subunit, nuclear factor; smal 97.84
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 97.81
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 97.81
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 97.81
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 97.8
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 97.79
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 97.7
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 97.63
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 97.34
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 97.21
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 96.91
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 96.89
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 96.77
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 96.75
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 96.67
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 96.67
2db0_A253 253AA long hypothetical protein; heat repeats, hel 96.63
2db0_A253 253AA long hypothetical protein; heat repeats, hel 96.61
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 96.6
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 96.56
3tpo_A 529 Importin subunit alpha-2; nuclear import, protein 96.47
3tjz_B 355 Coatomer subunit gamma; protein trafficking, golgi 96.4
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 95.89
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 95.74
2x1g_F 971 Cadmus; transport protein, developmental protein, 95.36
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 95.15
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 95.05
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 94.99
2x19_B 963 Importin-13; nuclear transport, protein transport; 94.98
2x1g_F 971 Cadmus; transport protein, developmental protein, 94.93
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 94.83
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 94.72
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 94.56
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 94.26
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 94.13
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 94.1
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 93.94
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 93.84
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 93.54
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 93.53
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.5
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 93.32
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 93.3
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 93.26
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 93.24
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 93.15
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 92.75
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 92.62
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 92.15
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 92.08
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 92.03
2x19_B 963 Importin-13; nuclear transport, protein transport; 91.91
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 91.38
3grl_A 651 General vesicular transport factor P115; vesicle t 91.04
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 89.94
3nmz_A458 APC variant protein; protein-protein complex, arma 89.52
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 89.14
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 88.32
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 88.13
3nmz_A458 APC variant protein; protein-protein complex, arma 87.07
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 86.98
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 86.62
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 86.52
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 86.32
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 85.5
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 83.09
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 82.61
3o2t_A 386 Symplekin; heat repeat, scaffold, protein binding; 82.29
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 82.21
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 81.7
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 81.37
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
Probab=99.84  E-value=2.8e-21  Score=188.34  Aligned_cols=173  Identities=50%  Similarity=0.765  Sum_probs=153.7

Q ss_pred             CchhHHHHHhhcccCCccchHHHHHHhhcCCCcccc------------cchhhhhHHHHhhHHHHHHhccCCChHHHHHH
Q psy18155          1 TRNVVAECLGKLTLIDPSNLLPRLQESLKSNSALMR------------TTPQSIDPLLRQTIGDFLSALKDSDLNVRRVA   68 (185)
Q Consensus         1 ~r~vvae~lg~l~~~~~~~~l~~L~~~l~~~~~~~r------------~~~~~~d~~L~~~i~~fl~~l~d~d~~vR~~a   68 (185)
                      +|+++|+|+|++...+|.+++|+|.+.++++++.+|            +++..+|.++.++++.|+.+++|+|..||+.|
T Consensus       947 ~r~~~a~~lg~l~~~~~~~l~p~l~~~l~~~~~~~R~~~~~~l~~~~~~~~~~~~~~l~~~~~~ll~~l~d~~~~vr~~a 1026 (1230)
T 1u6g_C          947 TRNVVAECLGKLTLIDPETLLPRLKGYLISGSSYARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVA 1026 (1230)
T ss_dssp             HHHHHHHHHHHHHHSSGGGTHHHHTTTSSSSCHHHHHHHHHHTGGGCCSSCCTHHHHHHHHSTTTHHHHSSSSTHHHHHH
T ss_pred             hHHHHHHHHhhhhccChHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHccCchhhHHHHHHHHHHHHHhcCCCcHHHHHHH
Confidence            489999999999999999999999999999888887            33345667899999999999999999999999


Q ss_pred             HHHHHHhhhcCchhhHHhHHhHHHHHHHHhhcCCCCCch--------------------------H---------HHhhH
Q psy18155         69 LVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDP--------------------------L---------LRQTI  113 (185)
Q Consensus        69 l~~ln~~~~~kp~ll~~~l~~~Lp~L~~~t~~~~~~vr~--------------------------~---------L~~~m  113 (185)
                      +.++++++|++|.++.++++++||.||+++..+++.||+                          +         +.+.+
T Consensus      1027 ~~~l~~~~~~~~~~~~~~l~~~lp~l~~~~~~~~~~~~~v~~gp~k~~vd~~l~~rk~a~~~~~~ll~~~~~~i~~~~~~ 1106 (1230)
T 1u6g_C         1027 LVTFNSAAHNKPSLIRDLLDTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFL 1106 (1230)
T ss_dssp             HHHHHHHHHHCGGGTGGGHHHHHHHHHHTTSCCGGGEEEEEETTEEEEEETHHHHHHHHHHHHHHHHHSSCSSSCHHHHH
T ss_pred             HHHHHHHHhcChHhHHHHHHHHHHHHHHHhcccHHhheeeccCCcccccCCcHHHHHHHHHHHHHHHHHHHHhCCHHHHH
Confidence            999999999999999999999999999999999986532                          2         23334


Q ss_pred             HHHHHhccCCCHHHHHHHHHHHHHHhhcChhhHHHhHhhHhhhh-------hhhhhhcchhhhhhccC
Q psy18155        114 GDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQL-------YAETAVKKTLIREVEMG  174 (185)
Q Consensus       114 ~~~l~~l~D~d~~Vr~~A~~~L~~~a~~~p~lv~~~L~~llp~L-------y~et~vk~el~R~vdmg  174 (185)
                      ..++.+++| |.++|..+|.++...++..|..+.++++++++++       .+++.+|||++|..|+.
T Consensus      1107 ~~~~~gl~d-~~di~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~qe~e~~~e~~ 1173 (1230)
T 1u6g_C         1107 NHVEDGLKD-HYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELK 1173 (1230)
T ss_dssp             HHHHHTTSS-CHHHHHHHHHHHHHHHHSCCHHHHTTTTTTHHHHHHHHHCCCCTTSCHHHHHHHHHHH
T ss_pred             HHHHcccCc-hHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHhhccccchhhhhHHHHHHHH
Confidence            577789988 5899999999999999999999999999999999       78899999999998874
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 185
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 5e-33
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 0.003
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HEAT repeat
domain: Cullin-associated NEDD8-dissociated protein 1 (Tip120)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  122 bits (305), Expect = 5e-33
 Identities = 83/208 (39%), Positives = 108/208 (51%), Gaps = 24/208 (11%)

Query: 2    RNVVAECLGKLTLIDPSNLLPRLQESLKSNS------------ALMRTTPQSIDPLLRQT 49
            ++  +  LG +++ +    LP + + + S               +   +   + P +   
Sbjct: 870  KSAASYALGSISVGNLPEYLPFVLQEITSQPKRQYLLLHSLKEIISSASVVGLKPYVENI 929

Query: 50   IGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLL------DSVLPQLYAETAVK-- 101
                L   + ++   R V            P  ++  L       S   +    TAVK  
Sbjct: 930  WALLLKHCECAEEGTRNVVAECLGKLTLIDPETLLPRLKGYLISGSSYARSSVVTAVKFT 989

Query: 102  ----PQSIDPLLRQTIGDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQL 157
                PQ IDPLL+  IGDFL  L+D DLNVRRVALV FNSAAHNKPSL+ DLLD+VLP L
Sbjct: 990  ISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVALVTFNSAAHNKPSLIRDLLDTVLPHL 1049

Query: 158  YAETAVKKTLIREVEMGPFKHTVDDGLD 185
            Y ET V+K LIREVEMGPFKHTVDDGLD
Sbjct: 1050 YNETKVRKELIREVEMGPFKHTVDDGLD 1077
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query185
d1u6gc_1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.94
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.91
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.2
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.3
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.97
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 97.89
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.87
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 97.67
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.67
d1ibrb_ 458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.66
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 97.58
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 97.44
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 97.32
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 97.16
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 97.11
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 97.06
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 96.92
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 96.82
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 96.49
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 96.34
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 96.03
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 95.99
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 95.92
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 95.7
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 95.45
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 95.29
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 95.24
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 94.87
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 94.15
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 92.23
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 89.9
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 89.06
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 86.88
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 82.78
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: HEAT repeat
domain: Cullin-associated NEDD8-dissociated protein 1 (Tip120)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=1.7e-28  Score=231.50  Aligned_cols=173  Identities=50%  Similarity=0.763  Sum_probs=150.5

Q ss_pred             CchhHHHHHhhcccCCccchHHHHHHhhcCCCcccc------------cchhhhhHHHHhhHHHHHHhccCCChHHHHHH
Q psy18155          1 TRNVVAECLGKLTLIDPSNLLPRLQESLKSNSALMR------------TTPQSIDPLLRQTIGDFLSALKDSDLNVRRVA   68 (185)
Q Consensus         1 ~r~vvae~lg~l~~~~~~~~l~~L~~~l~~~~~~~r------------~~~~~~d~~L~~~i~~fl~~l~d~d~~vR~~a   68 (185)
                      +|+++++|+|+++..+|.+++|.|.+++.++++.+|            +....++.++..+||.|+.+++|+|+.||+.|
T Consensus       944 vr~~~a~~lg~L~~~~~~~~lp~L~~~l~~~~~~~r~~ai~~l~~~~~~~~~~~~~~l~~li~~ll~~l~d~~~~vR~~a 1023 (1207)
T d1u6gc_         944 TRNVVAECLGKLTLIDPETLLPRLKGYLISGSSYARSSVVTAVKFTISDHPQPIDPLLKNCIGDFLKTLEDPDLNVRRVA 1023 (1207)
T ss_dssp             HHHHHHHHHHHHHHSSGGGTHHHHTTTSSSSCHHHHHHHHHHTGGGCCSSCCTHHHHHHHHSTTTHHHHSSSSTHHHHHH
T ss_pred             HHHHHHHHHHHHHhcCHHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHhcchhhHHHHHHHHHHHHHHhCCCCHHHHHHH
Confidence            489999999999999999999999999999999888            55566778899999999999999999999999


Q ss_pred             HHHHHHhhhcCchhhHHhHHhHHHHHHHHhhcCCCCCchH--------------------------H---------HhhH
Q psy18155         69 LVAFNSAAHNKPSLVIDLLDSVLPQLYAETAVKPQSIDPL--------------------------L---------RQTI  113 (185)
Q Consensus        69 l~~ln~~~~~kp~ll~~~l~~~Lp~L~~~t~~~~~~vr~~--------------------------L---------~~~m  113 (185)
                      +.|+|+++|+||+++.+|++.+||.||++|.+++|.||++                          |         ...+
T Consensus      1024 l~~l~~~~~~~p~li~~~l~~llp~l~~~t~~~~e~ir~v~~gp~kh~~d~gl~~rk~a~e~~~~~l~~~~~~~~~~~~~ 1103 (1207)
T d1u6gc_        1024 LVTFNSAAHNKPSLIRDLLDTVLPHLYNETKVRKELIREVEMGPFKHTVDDGLDIRKAAFECMYTLLDSCLDRLDIFEFL 1103 (1207)
T ss_dssp             HHHHHHHHHHCGGGTGGGHHHHHHHHHHTTSCCGGGEEEEEETTEEEEEETHHHHHHHHHHHHHHHHHSSCSSSCHHHHH
T ss_pred             HHHHHHHHHhChHHHHHHHHHHHHHHHHHhccchhheeeeecCCceeecCCcHHHHHHHHHHHHHHHHHhhhhcCHHHHH
Confidence            9999999999999999999999999999999999998652                          1         1122


Q ss_pred             HHHHHhccCCCHHHHHHHHHHHHHHhhcChhhHHHhHhhHhhhh-------hhhhhhcchhhhhhccC
Q psy18155        114 GDFLSALKDSDLNVRRVALVAFNSAAHNKPSLVIDLLDSVLPQL-------YAETAVKKTLIREVEMG  174 (185)
Q Consensus       114 ~~~l~~l~D~d~~Vr~~A~~~L~~~a~~~p~lv~~~L~~llp~L-------y~et~vk~el~R~vdmg  174 (185)
                      +.+..+++| +.+||..|+.+|.+.++..|..+.++|+.++|.+       .+++.+|||++|..|+.
T Consensus      1104 ~~~~~gl~d-~~di~~~~~~~l~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~q~~e~~~e~~ 1170 (1207)
T d1u6gc_        1104 NHVEDGLKD-HYDIKMLTFLMLVRLSTLCPSAVLQRLDRLVEPLRATCTTKVKANSVKQEFEKQDELK 1170 (1207)
T ss_dssp             HHHHHTTSS-CHHHHHHHHHHHHHHHHSCCHHHHTTTTTTHHHHHHHHHCCCCTTSCHHHHHHHHHHH
T ss_pred             HHHHhcccc-hHHHHHHHHHHHHHHHHhCcHHHHHHHHHHHHHHHHHHhcccCcchhhhhhHHHHHHH
Confidence            355566655 4567777778888999999999999999999999       67888999999988764
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure