Diaphorina citri psyllid: psy18159


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290----
MDQHEIDMSMNLTNSNNKKAESQNSRKTVLKSKQTTVSEKKEKSLIEHFDKEIQLEDKPKVTGPPSDVDDFDKETWEDPLQVSCYAMHIFEYLKSREAEFQIKDYLPFQSSTEKGNINAEMRSVLVDWMVEVQETFELNHETLYLAVKLVDLYLGKVVCSRLNLQLLGATAIFVSSKFDDRIPPQLSDLEYICSHTYSIQDLKDMEIKLVTAIGFDLGIPLSYRFLRRYARCNRIQLPLLTLARYILELSLMEYSLIRESDSKLACASLYLAQKMNKLTPWNKTLEYYSEEKLY
cccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccccccccEEEccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccccccHHHHHHcccccc
******************************************************************DVDDFDKETWEDPLQVSCYAMHIFEYLKSREAEFQIKDYLPFQSSTEKGNINAEMRSVLVDWMVEVQETFELNHETLYLAVKLVDLYLGKVVCSRLNLQLLGATAIFVSSKFDDRIPPQLSDLEYICSHTYSIQDLKDMEIKLVTAIGFDLGIPLSYRFLRRYARCNRIQLPLLTLARYILELSLMEYSLIRESDSKLACASLYLAQKMNKLTPWNKTLEYYSEEKLY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQHEIDMSMNLTNSNNKKAESQNSRKTVLKSKQTTVSEKKEKSLIEHFDKEIQLEDKPKVTGPPSDVDDFDKETWEDPLQVSCYAMHIFEYLKSREAEFQIKDYLPFQSSTEKGNINAEMRSVLVDWMVEVQETFELNHETLYLAVKLVDLYLGKVVCSRLNLQLLGATAIFVSSKFDDRIPPQLSDLEYICSHTYSIQDLKDMEIKLVTAIGFDLGIPLSYRFLRRYARCNRIQLPLLTLARYILELSLMEYSLIRESDSKLACASLYLAQKMNKLTPWNKTLEYYSEEKLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
G2/mitotic-specific cyclin-B3 Cyclins are positive regulatory subunits of the cyclin-dependent kinases (CDKs), and thereby play an essential role in the control of the cell cycle, notably via their destruction during cell division. Could be involved at the G2/M (mitosis or meiosis) transition. G2/M cyclins accumulate steadily during G2 and are abruptly destroyed at mitosis.confidentP39963
G2/mitotic-specific cyclin-B3 Cyclins are positive regulatory subunits of the cyclin-dependent kinases (CDKs), and thereby play an essential role in the control of the cell cycle, notably via their destruction during cell division. Probably functions redundantly with other cyclins in regulation of cell cycle. Its presence may be required to delay a deadline for completing cytokinesis that is ordinary imposed by nuclear envelope reformation. Degradation of CycB and CycB3 promote cytokinesis furrow initiation and ingression. Required with CycB for female fertility.confidentQ9I7I0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0010564 [BP]regulation of cell cycle processprobableGO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051726
GO:0051301 [BP]cell divisionprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005816 [CC]spindle pole bodyprobableGO:0043234, GO:0005575, GO:0005819, GO:0032991, GO:0005622, GO:0043232, GO:0005856, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630
GO:0016301 [MF]kinase activityprobableGO:0016772, GO:0016740, GO:0003674, GO:0003824
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016538 [MF]cyclin-dependent protein serine/threonine kinase regulator activityprobableGO:0030234, GO:0003674, GO:0019207, GO:0019887
GO:0007346 [BP]regulation of mitotic cell cycleprobableGO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051726
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0007067 [BP]mitosisprobableGO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049
GO:0071822 [BP]protein complex subunit organizationprobableGO:0043933, GO:0008150, GO:0071840, GO:0016043
GO:0001934 [BP]positive regulation of protein phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G33, chain B
Confidence level:very confident
Coverage over the Query: 85-293
View the alignment between query and template
View the model in PyMOL