Diaphorina citri psyllid: psy1815

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24

MDQGEVIVRPSSKGADHLTVTWKVADDLYQHIDVREEGKENSFSLGRSLWIGTEEFEDLDEIIARHVSPMAANVRELLSFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYPGKFLLSYLPASRSRHEFISVTPEGFRFRGQQFDSVNSLFRWFKEHFRDPIPGAGVAVGPGGQTPYGGARQTPGGGHLPYHTPGMTPHHRGMPTPLGHHSSNMGGPVLMHPPTGTPTPH

cccccEEEEccccccccEEEEEEEEcccEEEEEEEEcccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccEEEEEEccccccEEEEEEEccccccEEEEEEEcccEEEcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*DQGEVIVRPSSKGADHLTVTWKVADDLYQHIDVREEGKENSFSLGRSLWIGTEEFEDLDEIIARHVSPMAANVRELLSFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYPGKFLLSYLPASRSRHEFISVTPEGFRFRGQQFDSVNSLFRWFKEHFRDPI********************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription elongation factor SPT6	Acts to stimulate transcriptional elongation by RNA polymerase II.	confident	Q9W420
Transcription elongation factor SPT6	Acts to stimulate transcriptional elongation by RNA polymerase II.	confident	Q62383
Transcription elongation factor SPT6	Acts to stimulate transcriptional elongation by RNA polymerase II.	confident	Q8UVK2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044699 [BP]	single-organism process	probable	GO:0008150
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0009987 [BP]	cellular process	probable	GO:0008150
GO:0035327 [CC]	transcriptionally active chromatin	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0035363 [CC]	histone locus body	probable	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0000176 [CC]	nuclear exosome (RNase complex)	probable	GO:0043234, GO:0005575, GO:0000178, GO:0032991, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005705 [CC]	polytene chromosome interband	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005700, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0005623, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0005703 [CC]	polytene chromosome puff	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005700, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0005623, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PSI, chain A
Confidence level:very confident
Coverage over the Query: 78-119,134-165
View the alignment between query and template
View the model in PyMOL