Psyllid ID: psy1815

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------24
MDQGEVIVRPSSKGADHLTVTWKVADDLYQHIDVREEGKENSFSLGRSLWIGTEEFEDLDEIIARHVSPMAANVRELLSFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYPGKFLLSYLPASRSRHEFISVTPEGFRFRGQQFDSVNSLFRWFKEHFRDPIPGAGVAVGPGGQTPYGGARQTPGGGHLPYHTPGMTPHHRGMPTPLGHHSSNMGGPVLMHPPTGTPTPH
cccccEEEEccccccccEEEEEEEEcccEEEEEEEEcccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccEEEEEEccccccEEEEEEEccccccEEEEEEEcccEEEcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccEEEEEccccccEEEEEEEEcccEEEEEEEEEcccccccEcccEEEEccccHccHHHHHHHHHHHHHHHHHHHHHcHHHcccccccHHHHHHHHHHHHHHccccEEEEEEEccccccEEEEEEEccccccEEEEEEEcccEEEcccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mdqgevivrpsskgadhlTVTWKVADDLYQhidvreegkensFSLGRslwigteefeDLDEIIARHVSPMAANVRELLSFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLsknypgkfllsylpasrsrhefisvtpegfrfrgqqfdSVNSLFRWFKehfrdpipgagvavgpggqtpyggarqtpggghlpyhtpgmtphhrgmptplghhssnmggpvlmhpptgtptph
mdqgevivrpsskgadhltvTWKVADDLYQHIdvreegkensfslGRSLWIGTEEFEDLDEIIARHVSPMAANVRELLSFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYPGKFLLSYLPASRSRHEFISVTPEGFRFRGQQFDSVNSLFRWFKEHFRDPIPGAGVAVGPGGQTPYGGARQTPGGGHLPYHTPGMTPHHRGMPTPLGHHSSNMGGPVLMHPPTGTPTPH
MDQGEVIVRPSSKGADHLTVTWKVADDLYQHIDVREEGKENSFSLGRSLWIGTEEFEDLDEIIARHVSPMAANVRELLSFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYPGKFLLSYLPASRSRHEFISVTPEGFRFRGQQFDSVNSLFRWFKEHFRDPIpgagvavgpggQTPYGGARQTPGGGHLPYHTPGMTPHHRGMPTPLGHHSSNMGGPVLMHPPTGTPTPH
***************DHLTVTWKVADDLYQHIDVREEGKENSFSLGRSLWIGTEEFEDLDEIIARHVSPMAANVRELLSFRYYREECGGM*****************KIHYFVSLSKNYPGKFLLSYLPASRSRHEFISVTPEGFRFRGQQFDSVNSLFRWFKEHFRDPIPGAGVAV*************************************************************
*DQGEVIVRPSSKGADHLTVTWKVADDLYQHIDVREEGK****SLGRSLWIGTEEFEDLDEIIARHVSPMAANVRELLSFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYPGKFLLSYLPASRSRHEFISVTPEGFRFRGQQFDSVNSLFRWFKE**************************************************************************
MDQGEVIVRPSSKGADHLTVTWKVADDLYQHIDVREEGKENSFSLGRSLWIGTEEFEDLDEIIARHVSPMAANVRELLSFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYPGKFLLSYLPASRSRHEFISVTPEGFRFRGQQFDSVNSLFRWFKEHFRDPIPGAGVAVGPGGQTPYGGARQTPGGGHLPYHTPGMTPHHRGMPTPLGHHSSNMGGPVLMHPPTGTPTPH
***GEVIVRPSSKGADHLTVTWKVADDLYQHIDVREEGKENSFSLGRSLWIGTEEFEDLDEIIARHVSPMAANVRELLSFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYPGKFLLSYLPASRSRHEFISVTPEGFRFRGQQFDSVNSLFRWFKEHFRDPI*****************************HTPGMTPHHRGMPTPLGH**S*MGGP*L***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDQGEVIVRPSSKGADHLTVTWKVADDLYQHIDVREEGKENSFSLGRSLWIGTEEFEDLDEIIARHVSPMAANVRELLSFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYPGKFLLSYLPASRSRHEFISVTPEGFRFRGQQFDSVNSLFRWFKEHFRDPIPGAGVAVGPGGQTPYGGARQTPGGGHLPYHTPGMTPHHRGMPTPLGHHSSNMGGPVLMHPPTGTPTPH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query238 2.2.26 [Sep-21-2011]
Q9W420 1831 Transcription elongation yes N/A 0.844 0.109 0.581 4e-67
Q7KZ85 1726 Transcription elongation yes N/A 0.978 0.134 0.5 2e-63
Q62383 1726 Transcription elongation yes N/A 0.899 0.123 0.525 3e-62
Q8UVK2 1726 Transcription elongation yes N/A 0.932 0.128 0.508 1e-61
Q931481521 Suppressor of Ty 6 homolo N/A N/A 0.768 0.120 0.385 6e-34
P347031521 Suppressor of Ty 6 homolo yes N/A 0.710 0.111 0.391 1e-31
Q4PI891723 Transcription elongation N/A N/A 0.886 0.122 0.365 3e-28
Q8NIV61402 Transcription elongation N/A N/A 0.676 0.114 0.397 1e-27
Q4HYQ41408 Transcription elongation yes N/A 0.701 0.118 0.382 2e-25
Q4WWH61420 Transcription elongation yes N/A 0.684 0.114 0.372 9e-25
>sp|Q9W420|SPT6H_DROME Transcription elongation factor SPT6 OS=Drosophila melanogaster GN=Spt6 PE=1 SV=1 Back     alignment and function desciption
 Score =  254 bits (649), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 148/215 (68%), Gaps = 14/215 (6%)

Query: 2    DQGEVIVRPSSKGADHLTVTWKVADDLYQHIDVREEGKENSFSLGRSLWIGTEEFEDLDE 61
            DQGEV +RPSSK  DHLT TWKVADD++QHIDVREEGKEN FSLGRSLWIGTEEFEDLDE
Sbjct: 1356 DQGEVALRPSSKSKDHLTATWKVADDIFQHIDVREEGKENDFSLGRSLWIGTEEFEDLDE 1415

Query: 62   IIARHVSPMAANVRELLSFRYYREEC----GGMRDKAEEVLRQEKRNNPNKIHYFVSLSK 117
            IIARH+ PMA   REL+ ++YY+          RD  E++LR+EK N+P KIHYF + S+
Sbjct: 1416 IIARHIMPMALAARELIQYKYYKPNMVTGDENERDVMEKLLREEKANDPKKIHYFFTASR 1475

Query: 118  NYPGKFLLSYLPASRSRHEFISVTPEGFRFRGQQFDSVNSLFRWFKEHFRDPIPGAGVAV 177
              PGKFLLSYLP ++ RHE+++V PEG+RFRGQ FD+VNSL RWFKEH+ DP      A 
Sbjct: 1476 AMPGKFLLSYLPKTKVRHEYVTVMPEGYRFRGQIFDTVNSLLRWFKEHWLDPTATPASA- 1534

Query: 178  GPGGQTPY---------GGARQTPGGGHLPYHTPG 203
                 TP            + QT  G   PY   G
Sbjct: 1535 SASNLTPLHLMRPPPTISSSSQTSLGPQAPYSVTG 1569
Acts to stimulate transcriptional elongation by RNA polymerase II.
Drosophila melanogaster (taxid: 7227)
>sp|Q7KZ85|SPT6H_HUMAN Transcription elongation factor SPT6 OS=Homo sapiens GN=SUPT6H PE=1 SV=2 Back     alignment and function description
>sp|Q62383|SPT6H_MOUSE Transcription elongation factor SPT6 OS=Mus musculus GN=Supt6h PE=1 SV=2 Back     alignment and function description
>sp|Q8UVK2|SPT6H_DANRE Transcription elongation factor SPT6 OS=Danio rerio GN=supt6h PE=1 SV=1 Back     alignment and function description
>sp|Q93148|SPT6H_CAEBR Suppressor of Ty 6 homolog OS=Caenorhabditis briggsae GN=emb-5 PE=2 SV=2 Back     alignment and function description
>sp|P34703|SPT6H_CAEEL Suppressor of Ty 6 homolog OS=Caenorhabditis elegans GN=emb-5 PE=1 SV=1 Back     alignment and function description
>sp|Q4PI89|SPT6_USTMA Transcription elongation factor SPT6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SPT6 PE=3 SV=1 Back     alignment and function description
>sp|Q8NIV6|SPT6_NEUCR Transcription elongation factor spt-6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spt-6 PE=3 SV=1 Back     alignment and function description
>sp|Q4HYQ4|SPT6_GIBZE Transcription elongation factor SPT6 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPT6 PE=3 SV=1 Back     alignment and function description
>sp|Q4WWH6|SPT6_ASPFU Transcription elongation factor spt6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spt6 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
170044989 829 transcription elongation factor SPT6 [Cu 0.882 0.253 0.638 2e-79
380026998 1743 PREDICTED: transcription elongation fact 0.978 0.133 0.565 3e-78
307200348 1759 Transcription elongation factor SPT6 [Ha 0.857 0.115 0.620 1e-76
383864701 1740 PREDICTED: transcription elongation fact 0.966 0.132 0.585 1e-76
189240315 1797 PREDICTED: similar to Spt6 CG12225-PA [T 0.882 0.116 0.668 4e-76
270011547 1799 hypothetical protein TcasGA2_TC005584 [T 0.882 0.116 0.668 4e-76
350404740 1732 PREDICTED: transcription elongation fact 0.966 0.132 0.558 5e-76
383847186 1758 PREDICTED: transcription elongation fact 0.928 0.125 0.584 5e-75
350412618 1767 PREDICTED: transcription elongation fact 0.928 0.125 0.580 6e-75
328717138 1814 PREDICTED: transcription elongation fact 0.983 0.128 0.543 1e-74
>gi|170044989|ref|XP_001850107.1| transcription elongation factor SPT6 [Culex quinquefasciatus] gi|167868059|gb|EDS31442.1| transcription elongation factor SPT6 [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 136/213 (63%), Positives = 170/213 (79%), Gaps = 3/213 (1%)

Query: 1   MDQGEVIVRPSSKGADHLTVTWKVADDLYQHIDVREEGKENSFSLGRSLWIGTEEFEDLD 60
           +DQGEV+VRPSSKGADHLT +WKV +D+YQHID+REEGKEN FSLG+SLWIG EEFEDLD
Sbjct: 588 LDQGEVVVRPSSKGADHLTASWKVTNDVYQHIDIREEGKENVFSLGQSLWIGNEEFEDLD 647

Query: 61  EIIARHVSPMAANVRELLSFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYP 120
           EIIAR+++PMAA VR+LL+++YY++  GGM+DKAEE+L+ EK  NPNKIHY +S++KNYP
Sbjct: 648 EIIARYITPMAAYVRDLLNYKYYKDTGGGMKDKAEEILKDEKSKNPNKIHYVMSVAKNYP 707

Query: 121 GKFLLSYLPASRSRHEFISVTPEGFRFRGQQFDSVNSLFRWFKEHFRDPIPGAGVAVGPG 180
           GKFLLSYLP ++ +HE+I+V PEG+RFR Q FDSVNSL +WFKEHFRDPIP A  A  P 
Sbjct: 708 GKFLLSYLPRTKCKHEYITVNPEGYRFRSQNFDSVNSLLKWFKEHFRDPIPSATPASTPR 767

Query: 181 GQTPYGGARQTPGGGHLPYHTPGMTPHHRGMPT 213
           G T    A +TP  G   Y    +    + +P+
Sbjct: 768 GAT---SASRTPFSGSPKYSNDAIQKLAQNIPS 797

Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380026998|ref|XP_003697224.1| PREDICTED: transcription elongation factor SPT6-like [Apis florea] Back     alignment and taxonomy information
>gi|307200348|gb|EFN80602.1| Transcription elongation factor SPT6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383864701|ref|XP_003707816.1| PREDICTED: transcription elongation factor SPT6-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|189240315|ref|XP_967189.2| PREDICTED: similar to Spt6 CG12225-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270011547|gb|EFA07995.1| hypothetical protein TcasGA2_TC005584 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350404740|ref|XP_003487205.1| PREDICTED: transcription elongation factor SPT6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383847186|ref|XP_003699236.1| PREDICTED: transcription elongation factor SPT6-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350412618|ref|XP_003489706.1| PREDICTED: transcription elongation factor SPT6-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328717138|ref|XP_003246129.1| PREDICTED: transcription elongation factor SPT6-like isoform 2 [Acyrthosiphon pisum] gi|328717140|ref|XP_001950257.2| PREDICTED: transcription elongation factor SPT6-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query238
FB|FBgn0028982 1831 Spt6 "Spt6" [Drosophila melano 0.915 0.119 0.559 1.4e-60
UNIPROTKB|E1C1S5 1659 Gga.31080 "Uncharacterized pro 0.823 0.118 0.563 2.3e-57
UNIPROTKB|E1BEB8 1726 SUPT6H "Uncharacterized protei 0.823 0.113 0.558 4.1e-57
UNIPROTKB|F1RNB0 1725 F1RNB0 "Uncharacterized protei 0.823 0.113 0.558 5.3e-57
UNIPROTKB|E2R4A3 1726 SUPT6H "Uncharacterized protei 0.823 0.113 0.558 5.3e-57
UNIPROTKB|Q7KZ85 1726 SUPT6H "Transcription elongati 0.823 0.113 0.558 5.3e-57
UNIPROTKB|F1LR36 1726 Supt6h "Protein Supt6h" [Rattu 0.823 0.113 0.558 5.3e-57
ZFIN|ZDB-GENE-030131-7949 1726 supt6h "suppressor of Ty 6 hom 0.714 0.098 0.605 3.2e-56
MGI|MGI:107726 1726 Supt6 "suppressor of Ty 6" [Mu 0.823 0.113 0.553 4.8e-56
TAIR|locus:2206330 1647 GTB1 "global transcription fac 0.697 0.100 0.402 3.3e-32
FB|FBgn0028982 Spt6 "Spt6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 634 (228.2 bits), Expect = 1.4e-60, P = 1.4e-60
 Identities = 132/236 (55%), Positives = 156/236 (66%)

Query:     2 DQGEVIVRPSSKGADHLTVTWKVADDLYQHIDVREEGKENSFSLGRSLWIGTEEFEDLDE 61
             DQGEV +RPSSK  DHLT TWKVADD++QHIDVREEGKEN FSLGRSLWIGTEEFEDLDE
Sbjct:  1356 DQGEVALRPSSKSKDHLTATWKVADDIFQHIDVREEGKENDFSLGRSLWIGTEEFEDLDE 1415

Query:    62 IIARHVSPMAANVRELLSFRYYREEC--G--GMRDKAEEVLRQEKRNNPNKIHYFVSLSK 117
             IIARH+ PMA   REL+ ++YY+     G    RD  E++LR+EK N+P KIHYF + S+
Sbjct:  1416 IIARHIMPMALAARELIQYKYYKPNMVTGDENERDVMEKLLREEKANDPKKIHYFFTASR 1475

Query:   118 NYPGKFLLSYLPASRSRHEFISVTPEGFRFRGQQFDSVNSLFRWFKEHFRDPIXXXXXXX 177
               PGKFLLSYLP ++ RHE+++V PEG+RFRGQ FD+VNSL RWFKEH+ DP        
Sbjct:  1476 AMPGKFLLSYLPKTKVRHEYVTVMPEGYRFRGQIFDTVNSLLRWFKEHWLDPTATPASAS 1535

Query:   178 XXXXQTPY---------GGARQTPGGGHLPYHTPGMTPHHRGMPTPLGHHSSNMGG 224
                  TP            + QT  G   PY   G      G  TP    SS +GG
Sbjct:  1536 ASNL-TPLHLMRPPPTISSSSQTSLGPQAPYSVTGSVTG--G--TPRSGISSAVGG 1586
GO:0003682 "chromatin binding" evidence=ISS;IDA
GO:0005703 "polytene chromosome puff" evidence=IDA
GO:0005705 "polytene chromosome interband" evidence=IDA
GO:0006366 "transcription from RNA polymerase II promoter" evidence=IEP
GO:0035327 "transcriptionally active chromatin" evidence=IDA
GO:0000176 "nuclear exosome (RNase complex)" evidence=IDA
GO:0008023 "transcription elongation factor complex" evidence=IPI
GO:0035101 "FACT complex" evidence=IPI
GO:0003723 "RNA binding" evidence=IEA
GO:0016788 "hydrolase activity, acting on ester bonds" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0032968 "positive regulation of transcription elongation from RNA polymerase II promoter" evidence=IMP
GO:0002805 "regulation of antimicrobial peptide biosynthetic process" evidence=IMP
GO:0035363 "histone locus body" evidence=IDA
UNIPROTKB|E1C1S5 Gga.31080 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BEB8 SUPT6H "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RNB0 F1RNB0 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R4A3 SUPT6H "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q7KZ85 SUPT6H "Transcription elongation factor SPT6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LR36 Supt6h "Protein Supt6h" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7949 supt6h "suppressor of Ty 6 homolog" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:107726 Supt6 "suppressor of Ty 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2206330 GTB1 "global transcription factor group B1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8UVK2SPT6H_DANRENo assigned EC number0.50890.93270.1286yesN/A
Q62383SPT6H_MOUSENo assigned EC number0.52550.89910.1239yesN/A
Q9W420SPT6H_DROMENo assigned EC number0.58130.84450.1097yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
cd0992889 cd09928, SH2_Cterm_SPT6_like, C-terminal Src homol 1e-37
cd0991885 cd09918, SH2_Nterm_SPT6_like, N-terminal Src homol 3e-36
smart0025284 smart00252, SH2, Src homology 2 domains 6e-05
>gnl|CDD|198182 cd09928, SH2_Cterm_SPT6_like, C-terminal Src homology 2 (SH2) domain found in Spt6 Back     alignment and domain information 
 Score =  126 bits (319), Expect = 1e-37
 Identities = 50/93 (53%), Positives = 67/93 (72%), Gaps = 5/93 (5%)

Query: 75  RELLSFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYPGKFLLSYLPAS-RS 133
             L   +Y+R      +++ E++L++EK+ NP +I Y   +SK YPGKFLLSYLPA+ R 
Sbjct: 1   EMLNHHKYFRGT----KEEVEKLLKEEKKANPKRIPYAFCVSKKYPGKFLLSYLPANTRV 56

Query: 134 RHEFISVTPEGFRFRGQQFDSVNSLFRWFKEHF 166
           RHE++ VTP+GFRFRGQ F SV+SL  WFKEHF
Sbjct: 57  RHEYVKVTPDGFRFRGQVFPSVDSLLNWFKEHF 89

Spt6 is an essential transcription elongation factor and histone chaperone that binds the C-terminal repeat domain (CTD) of RNA polymerase II. Spt6 contains a tandem SH2 domain with a novel structure and CTD-binding mode. The tandem SH2 domain binds to a serine 2-phosphorylated CTD peptide in vitro, whereas its N-terminal SH2 subdomain does not. CTD binding requires a positively charged crevice in the C-terminal SH2 subdomain, which lacks the canonical phospho-binding pocket of SH2 domains. The tandem SH2 domain is apparently required for transcription elongation in vivo as its deletion in cells is lethal in the presence of 6-azauracil. In general SH2 domains are involved in signal transduction. They typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites. Length = 89
>gnl|CDD|198174 cd09918, SH2_Nterm_SPT6_like, N-terminal Src homology 2 (SH2) domain found in Spt6 Back     alignment and domain information
>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 238
PF14633220 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ 100.0
KOG1856|consensus1299 100.0
KOG0790|consensus 600 99.76
smart0025284 SH2 Src homology 2 domains. Src homology 2 domains 98.65
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 98.61
PF0001777 SH2: SH2 domain; InterPro: IPR000980 The Src homol 98.61
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 98.59
smart0025284 SH2 Src homology 2 domains. Src homology 2 domains 98.55
PF0001777 SH2: SH2 domain; InterPro: IPR000980 The Src homol 98.51
KOG1264|consensus 1267 98.01
KOG4792|consensus 293 97.34
KOG1264|consensus 1267 96.96
KOG4226|consensus379 96.88
KOG4226|consensus379 96.51
KOG0790|consensus 600 96.16
KOG0194|consensus 474 94.08
PF14633220 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ 94.08
KOG4637|consensus 464 93.98
KOG4792|consensus293 92.98
KOG3601|consensus222 92.77
KOG2996|consensus865 89.69
KOG2996|consensus865 88.78
KOG0194|consensus 474 88.59
KOG0197|consensus 468 86.6
KOG1930|consensus483 86.44
KOG4278|consensus 1157 86.24
>PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A Back     alignment and domain information 
Probab=100.00  E-value=5.2e-67  Score=461.31  Aligned_cols=163  Identities=60%  Similarity=1.059  Sum_probs=149.9

Q ss_pred             CCCccEEEecCCCCCCcEEEEEEeeCCeeEEEEEEeCCCCCcccccceEeECCeeeCCHHHHHHHHHHHHHHHHHHHhcC
Q psy1815           1 MDQGEVIVRPSSKGADHLTVTWKVADDLYQHIDVREEGKENSFSLGRSLWIGTEEFEDLDEIIARHVSPMAANVRELLSF   80 (238)
Q Consensus         1 ~~~Ge~IIRPSSkG~dhLtvTwKv~d~vyqHidI~E~~K~n~~sLG~~L~Ig~eefeDLDEIIaryV~pm~~~v~dl~~H   80 (238)
                      +++|||||||||||.|||+|||||+|||||||||+|.+|+|++|||++|+|++++|+||||||+|||+||+++|+||++|
T Consensus        56 ~~~Ge~iIRPSSkG~dhL~vTwKv~d~vyqHidV~E~~K~n~~slG~~L~i~~~~yeDLDEii~r~V~pm~~~v~~~~~h  135 (220)
T PF14633_consen   56 QDVGEVIIRPSSKGPDHLTVTWKVADGVYQHIDVKEEDKENEFSLGKTLKIGGEEYEDLDEIIARHVEPMARNVEEMMNH  135 (220)
T ss_dssp             S-TT-EEEEE-TTTTTEEEEEEEEETTEEEEEEEEEECSSSTTS-SSEEEETTEEESSHHHHHHHCHHHHHHHHHHHHCS
T ss_pred             CCCCCEEEeeCCCCCCeEEEEEEEcCCcEEEEEEEECCCcCccccCcEEEECCeEECCHHHHHHHHHHHHHHHHHHHHhC
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccCCCCHHHHHHHHHHHHhcCCCcceEEEEeCCCCCceEEEEEecCCCcceEE--EEEeeCceEeccccccCHHHH
Q psy1815          81 RYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYPGKFLLSYLPASRSRHEF--ISVTPEGFRFRGQQFDSVNSL  158 (238)
Q Consensus        81 rkF~~~~~gs~~eve~~L~~ek~~nP~ri~Y~f~~s~~~PG~F~L~y~~~~~~~~e~--I~V~p~Gf~fr~~~f~sl~~L  158 (238)
                      |||++   |+++++|++|++||++||++|||+||+++++||+|+|+|+++.++++++  |+|+|+||+|++++|+||++|
T Consensus       136 ~kf~~---g~~~e~e~~L~~~k~~nP~~i~Y~f~~~~~~PG~F~L~y~~~~~~~~~~~~v~V~p~Gf~~r~~~f~~~~~L  212 (220)
T PF14633_consen  136 RKFKD---GTKEEVEEWLKEEKKANPKRIPYAFCISKEHPGYFILSYKPNKNPRHEYWPVKVTPDGFRFRKQVFPSLDRL  212 (220)
T ss_dssp             TTEES---S-CCCCHHHHHCHHHHSTTS-EEEEEE-TTSTTEEEEEEESSTTS-EEEEEEEE-SSSEEETTEEESSHHHH
T ss_pred             ccccC---CCHHHHHHHHHHHHHhCCCCceEEEEECCCCCCEEEEEEEcCCCCceEEeeEEEecCcEEEecccCCCHHHH
Confidence            99995   8999999999999999999999999999999999999999999998765  999999999999999999999


Q ss_pred             HHHHHhcc
Q psy1815         159 FRWFKEHF  166 (238)
Q Consensus       159 i~~FK~~~  166 (238)
                      |+|||+||
T Consensus       213 ~~~FK~~~  220 (220)
T PF14633_consen  213 INWFKKHY  220 (220)
T ss_dssp             HHHHHHH-
T ss_pred             HHHHhhcC
Confidence            99999986

>KOG1856|consensus Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>smart00252 SH2 Src homology 2 domains Back     alignment and domain information
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information
>PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] Back     alignment and domain information
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information
>smart00252 SH2 Src homology 2 domains Back     alignment and domain information
>PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A Back     alignment and domain information
>KOG4637|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG1930|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
3psi_A1219 Crystal Structure Of The Spt6 Core Domain From Sacc 2e-20
2l3t_A199 Solution Structure Of Tandem Sh2 Domain From Spt6 L 2e-20
3psk_A211 Crystal Structure Of The Spt6 Tandem Sh2 Domain Fro 2e-20
3psj_A210 Crystal Structure Of The Spt6 Tandem Sh2 Domain Fro 5e-20
3pjp_A199 A Tandem Sh2 Domain In Transcription Elongation Fac 2e-18
3gxw_A103 Structure Of The Sh2 Domain Of The Candida Glabrata 2e-12
>pdb|3PSI|A Chain A, Crystal Structure Of The Spt6 Core Domain From Saccharomyces Cerevisiae, Form Spt6(239-1451) Length = 1219 Back     alignment and structure 
Iteration: 1

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 53/164 (32%), Positives = 89/164 (54%), Gaps = 5/164 (3%)
Query: 2    DQGEVIVRPSSKGADHLTVTWKVADDLYQHIDVREEGKENSFSLGRSLWIGTEEFEDLDE 61
            ++GE ++R SS+G DHL +TWK+  DL+QHID++E  KEN  +LG+ L +  +++ DLD+
Sbjct: 1043 ERGEFVIRQSSRGDDHLVITWKLDKDLFQHIDIQELEKENPLALGKVLIVDNQKYNDLDQ 1102
Query: 62   IIARHVSPMAANVRELLSFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYPG 121
            II  ++      + E+ S   ++    G +    + +    R NPNK  Y+ SL+ + PG
Sbjct: 1103 IIVEYLQNKVRLLNEMTSSEKFKS---GTKKDVVKFIEDYSRVNPNKSVYYFSLNHDNPG 1159
Query: 122  KFLLSYLPASRSRHEF--ISVTPEGFRFRGQQFDSVNSLFRWFK 163
             F L +   + S+     + +T  G+      + SV  L   FK
Sbjct: 1160 WFYLMFKINANSKLYTWNVKLTNTGYFLVNYNYPSVIQLCNGFK 1203
>pdb|2L3T|A Chain A, Solution Structure Of Tandem Sh2 Domain From Spt6 Length = 199 Back     alignment and structure
>pdb|3PSK|A Chain A, Crystal Structure Of The Spt6 Tandem Sh2 Domain From Saccharomyces Cerevisiae, Form Native Spt6 (1247-1451) Length = 211 Back     alignment and structure
>pdb|3PSJ|A Chain A, Crystal Structure Of The Spt6 Tandem Sh2 Domain From Saccharomyces Cerevisiae, Form Se-Spt6 (1247-1451) Length = 210 Back     alignment and structure
>pdb|3PJP|A Chain A, A Tandem Sh2 Domain In Transcription Elongation Factor Spt6 Binds The Phosphorylated Rna Polymerase Ii C-Terminal Repeat Domain(Ctd) Length = 199 Back     alignment and structure
>pdb|3GXW|A Chain A, Structure Of The Sh2 Domain Of The Candida Glabrata Transcription Elongation Factor Spt6, Crystal Form A Length = 103 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query238
3psi_A1219 Transcription elongation factor SPT6; nucleus; 3.3 2e-87
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 8e-78
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 5e-60
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 4e-05
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 1e-04
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 4e-04
>3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Length = 1219 Back     alignment and structure
 Score =  279 bits (716), Expect = 2e-87
 Identities = 53/175 (30%), Positives = 89/175 (50%), Gaps = 5/175 (2%)

Query: 1    MDQGEVIVRPSSKGADHLTVTWKVADDLYQHIDVREEGKENSFSLGRSLWIGTEEFEDLD 60
             ++GE ++R SS+G DHL +TWK+  DL+QHID++E  KEN  +LG+ L +  +++ DLD
Sbjct: 1042 KERGEFVIRQSSRGDDHLVITWKLDKDLFQHIDIQELEKENPLALGKVLIVDNQKYNDLD 1101

Query: 61   EIIARHVSPMAANVRELLSFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYP 120
            +II  ++      + E+ S   ++    G +    + +    R NPNK  Y+ SL+ + P
Sbjct: 1102 QIIVEYLQNKVRLLNEMTSSEKFKS---GTKKDVVKFIEDYSRVNPNKSVYYFSLNHDNP 1158

Query: 121  GKFLLSYLPA--SRSRHEFISVTPEGFRFRGQQFDSVNSLFRWFKEHFRDPIPGA 173
            G F L +     S+     + +T  G+      + SV  L   FK   +      
Sbjct: 1159 GWFYLMFKINANSKLYTWNVKLTNTGYFLVNYNYPSVIQLCNGFKTLLKSNSSKN 1213
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Length = 178 Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 100.0
3psi_A1219 Transcription elongation factor SPT6; nucleus; 3.3 100.0
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 100.0
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 99.68
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 99.67
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 99.66
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.57
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 99.45
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 99.4
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.36
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.34
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 98.85
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 98.85
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 98.84
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 98.84
2vif_A141 Suppressor of cytokine signalling 6; growth regula 98.77
2dly_A121 FYN-related kinase; BRK family kinase, structural 98.74
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 98.74
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 98.73
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 98.73
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 98.71
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 98.7
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 98.69
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 98.69
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 98.69
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 98.69
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 98.67
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 98.67
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 98.66
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 98.66
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 98.65
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 98.65
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 98.62
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 98.61
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 98.59
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 98.58
2aug_A126 Growth factor receptor-bound protein 14; phosphory 98.58
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 98.58
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 98.58
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 98.58
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 98.56
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 98.56
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 98.55
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 98.55
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 98.55
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 98.54
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.53
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 98.52
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 98.51
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 98.51
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 98.5
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 98.49
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 98.48
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 98.47
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 98.47
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 98.45
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 98.44
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 98.44
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 98.43
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 98.42
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 98.41
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 98.4
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 98.4
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 98.37
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 98.34
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 98.33
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 98.33
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 98.32
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 98.31
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 98.28
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 98.28
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 98.28
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 98.28
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 98.27
2dly_A121 FYN-related kinase; BRK family kinase, structural 98.25
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 98.24
3qwy_A 308 Cell death abnormality protein 2; cell engulfment, 98.23
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 98.23
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 98.23
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 98.23
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 98.21
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 98.21
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 98.21
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 98.2
2vif_A141 Suppressor of cytokine signalling 6; growth regula 98.2
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 98.2
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 98.19
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 98.18
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 98.17
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 98.17
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 98.16
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 98.16
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.16
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 98.15
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 98.15
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 98.15
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 98.13
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 98.12
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 98.11
2lqn_A 303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 97.35
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 98.08
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 98.07
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 98.06
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 98.05
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 98.05
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 98.02
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 98.02
2eyz_A 304 V-CRK sarcoma virus CT10 oncogene homolog isoform 98.01
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 98.0
2aug_A126 Growth factor receptor-bound protein 14; phosphory 98.0
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 97.99
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 97.97
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 97.96
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 97.96
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 97.95
3maz_A125 Signal-transducing adaptor protein 1; modular doma 97.95
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 97.91
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 97.91
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 97.91
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 97.88
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 97.87
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 97.83
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 97.8
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 97.76
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 97.76
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 97.74
3hhm_B 373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 97.73
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 97.72
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 97.62
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 97.6
3maz_A125 Signal-transducing adaptor protein 1; modular doma 97.55
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 97.48
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 97.48
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 97.48
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 97.4
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 97.34
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 97.27
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 97.24
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 97.22
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 97.2
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 97.1
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 96.16
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 97.07
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 96.87
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 96.79
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 96.7
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 96.31
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 96.19
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 96.04
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 95.89
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 95.69
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 94.92
3op0_A323 Signal transduction protein CBL-C; structural geno 94.86
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 94.74
>3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 238
d1mila_104 d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap 1e-05
d2qmsa1113 d.93.1.1 (A:420-532) Growth factor receptor-bound 2e-05
d1rjaa_100 d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu 3e-05
d2c9wa2103 d.93.1.1 (A:32-134) Suppressor of cytokine signali 4e-05
d1rpya_86 d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor 5e-05
d1nrva_105 d.93.1.1 (A:) Growth factor receptor-bound protein 5e-04
d1d4ta_104 d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap 5e-04
d2izva2112 d.93.1.1 (A:274-385) Suppressor of cytokine signal 9e-04
d2fcia1105 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B 0.002
d1qada_107 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 0.002
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: SH2-like
superfamily: SH2 domain
family: SH2 domain
domain: Shc adaptor protein
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 40.7 bits (95), Expect = 1e-05
 Identities = 20/87 (22%), Positives = 40/87 (45%), Gaps = 8/87 (9%)

Query: 91  RDKAEEVLRQEKRNNPNKIHYFVSLSKNYPGKFLLSYLPASRSRHEFISVTPEGFRFRGQ 150
           R +AE +L+           + V  S   PG+++L+ L + + +H  +       R +  
Sbjct: 16  RREAEALLQLNG-------DFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDH 68

Query: 151 QFDSVNSLFRWFKEHFRDPIPGAGVAV 177
           +F+SV+ L  +  ++   PI  AG  +
Sbjct: 69  RFESVSHLISYHMDN-HLPIISAGSEL 94
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query238
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 98.86
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 98.85
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 98.77
d2c9wa2103 Suppressor of cytokine signaling 2, SOCS-2 {Human 98.73
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 98.73
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.72
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 98.7
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 98.65
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 98.65
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 98.63
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 98.62
d2c9wa2103 Suppressor of cytokine signaling 2, SOCS-2 {Human 98.61
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 98.6
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 98.6
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 98.6
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 98.57
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 98.56
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 98.55
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 98.55
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 98.55
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 98.53
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 98.52
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 98.5
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 98.49
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 98.48
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 98.47
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 98.44
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 98.44
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 98.42
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 98.41
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 98.41
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 98.4
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 98.4
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 98.39
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 98.35
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.35
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 98.34
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 98.34
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 98.34
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 98.23
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 98.23
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 98.23
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 98.22
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 98.22
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 98.19
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 98.19
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 98.11
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 98.11
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 98.1
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 98.09
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 98.04
d1xa6a2141 Beta-chimaerin, N-terminal domain {Human (Homo sap 98.03
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 98.03
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 98.03
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 98.02
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 97.97
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 97.96
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 97.96
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 97.93
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 97.93
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 97.9
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 97.74
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 97.55
d1xa6a2141 Beta-chimaerin, N-terminal domain {Human (Homo sap 97.48
d1uura3131 STAT homologue {Dictyostelium discoideum [TaxId: 4 94.86
d1uura3131 STAT homologue {Dictyostelium discoideum [TaxId: 4 94.72
d1bg1a3141 STAT3b {Mouse (Mus musculus) [TaxId: 10090]} 88.52
d1bg1a3141 STAT3b {Mouse (Mus musculus) [TaxId: 10090]} 81.13
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: SH2-like
superfamily: SH2 domain
family: SH2 domain
domain: Tyrosine phoshatase shp-2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.86  E-value=7.8e-09  Score=78.46  Aligned_cols=83  Identities=23%  Similarity=0.331  Sum_probs=71.1

Q ss_pred             cCccccccCCCCHHHHHHHHHHHHhcCCCcceEEEEeCCCCCceEEEEEecCCCcceEEEEEeeCceEec-cccccCHHH
Q psy1815          79 SFRYYREECGGMRDKAEEVLRQEKRNNPNKIHYFVSLSKNYPGKFLLSYLPASRSRHEFISVTPEGFRFR-GQQFDSVNS  157 (238)
Q Consensus        79 ~HrkF~~~~~gs~~eve~~L~~ek~~nP~ri~Y~f~~s~~~PG~F~L~y~~~~~~~~e~I~V~p~Gf~fr-~~~f~sl~~  157 (238)
                      +.+||+.  ..+++++|++|++.    +.-..|.+..|...||.|+|++.-+.++.|--|....++|.+. +..|+||.+
T Consensus         2 ~~~Wy~g--~isR~~Ae~lL~~~----~~~G~FLvR~S~~~~g~y~LSv~~~~~v~H~~I~~~~~~~~~~~~~~F~sl~~   75 (109)
T d2shpa2           2 SRRWFHP--NITGVEAENLLLTR----GVDGSFLARPSKSNPGDLTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAE   75 (109)
T ss_dssp             CSTTBCS--SCCHHHHHHHHHHH----CCTTEEEEEECSSSTTCEEEEEEETTEEEEEEEECSSSCEEETTSCEESSHHH
T ss_pred             CCccccC--CCCHHHHHHHHhhC----CCCCeEEEEecCCCCCCEEEEEEeCCcEEEEEEEEcCCeEEEcCCcccCCHHH
Confidence            4689997  48999999999643    2236799999999999999999988888888888888999985 788999999


Q ss_pred             HHHHHHhccC
Q psy1815         158 LFRWFKEHFR  167 (238)
Q Consensus       158 Li~~FK~~~~  167 (238)
                      ||+||+++..
T Consensus        76 LV~~y~~~~~   85 (109)
T d2shpa2          76 LVQYYMEHHG   85 (109)
T ss_dssp             HHHHHHTCTT
T ss_pred             HHHHHHHCCC
Confidence            9999998764
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure