Diaphorina citri psyllid: psy18174


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MKMPAGEEEFTTLELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQDGCQVVCLLVLKYR
ccccccccccccccccccHHHHHHHHHcccccEEEEEccccHHHHHccccccEEECcccHHHHcccccccccccccccHHHHHHHHHHccccEEEEEccccccccccccccccccccccHHHHHHHHHHHccccEEEEEEcccc
***************CVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFVVYGDSCMS**********CYTASDTMNVLTKRLQQDGCQVVCLLVLKYR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMPAGEEEFTTLELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQDGCQVVCLLVLKYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dual specificity protein phosphatase Mpk3 Negatively regulates the activity of members of the MAP kinase family in response to changes in the cellular environment. Has a specificity for the ERK family. Acts as negative regulator in a variety of developmental processes including cell differentiation and proliferation controlled by the Ras/ERK pathway. Suppresses the photoreceptor cell differentiation and wing vein formation. Required for proper oogenesis and early embryogenesis. Functions autonomously in a subset of photoreceptor progenitor cells in eye imaginal disks. Appears also to be required in surrounding non-neuronal cells for ommatidial patterning and photoreceptor differentiation. Plays a role in the maintenance of epithelial integrity during tracheal development.confidentQ9VVW5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004721 [MF]phosphoprotein phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HZM, chain A
Confidence level:very confident
Coverage over the Query: 8-141
View the alignment between query and template
View the model in PyMOL