Psyllid ID: psy18174

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MKMPAGEEEFTTLELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQDGCQVVCLLVLKYR
ccccccccccccccccccHHHHHHHHHcccccEEEEEccccHHHHHccccccEEEEcccHHHHcccccccccccccccHHHHHHHHHHccccEEEEEccccccccccccHHccccccccHHHHHHHHHHHccccEEEEEEcccc
cccccccccccccHHcccHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHEEEccHHHHHHHHHcccccHHHHcccHHHHHHHHHHccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHcccEEEEEEEEEcc
mkmpageeeftTLELCVSKSWLLqelrsdpsrliildcrssneyteshirhavnfsiPSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFVVYgdscmsevevrdrekhcytasDTMNVLTKRLQQDGCQVVCLLVLKYR
mkmpageeefttlELCVSKSWLLQELRSDPSRLIILDCRSsneyteshirhavnfsipSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTkrlqqdgcqvvcllvlkyr
MKMPAGEEEFTTLELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQDGCQVVCLLVLKYR
*********FTTLELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQDGCQVVCLLVLK**
****************VSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTI***********AYKDSLFVVYGDSCMS***********YTASDTMNVLTKRLQQDGCQVVCLLVLKYR
*********FTTLELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQDGCQVVCLLVLKYR
***************CVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFVVYGDSCMS**********CYTASDTMNVLTKRLQQDGCQVVCLLVLKYR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKMPAGEEEFTTLELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQDGCQVVCLLVLKYR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query144 2.2.26 [Sep-21-2011]
Q9VVW5 411 Dual specificity protein yes N/A 0.881 0.309 0.503 4e-25
Q91Z46 422 Dual specificity protein yes N/A 0.812 0.277 0.314 8e-11
Q16829 419 Dual specificity protein yes N/A 0.812 0.279 0.314 9e-11
Q9DBB1 381 Dual specificity protein no N/A 0.416 0.157 0.416 2e-08
Q16828 381 Dual specificity protein no N/A 0.604 0.228 0.337 5e-08
Q2KJ36 381 Dual specificity protein no N/A 0.604 0.228 0.337 6e-08
Q64346 381 Dual specificity protein no N/A 0.409 0.154 0.409 2e-07
Q9ESS0 483 Dual specificity protein no N/A 0.666 0.198 0.301 1e-05
Q9Y6W6 482 Dual specificity protein no N/A 0.430 0.128 0.396 4e-05
Q0IID7 482 Dual specificity protein no N/A 0.430 0.128 0.396 4e-05
>sp|Q9VVW5|DUSK3_DROME Dual specificity protein phosphatase Mpk3 OS=Drosophila melanogaster GN=Mkp3 PE=1 SV=2 Back     alignment and function desciption
 Score =  113 bits (282), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 87/131 (66%), Gaps = 4/131 (3%)

Query: 11  TTLELCVSKSWLLQELRS-DPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGK 69
           T  E C SK WL  +LRS D   LI+LDCR S+EY+ESHIR AVN  IPSI+LRRLA GK
Sbjct: 4   TEHETC-SKEWLQSQLRSLDSKDLILLDCRGSHEYSESHIRGAVNLCIPSIVLRRLAVGK 62

Query: 70  IELLSTIKCRELKEKIMNAYKDSLFVVY-GDSCMSEVEVRDREKHCYTASDT-MNVLTKR 127
           I+L STIK  ELK++I + YK   F++Y G+    + +          A D+ +++L +R
Sbjct: 63  IDLASTIKSPELKQRIQSGYKLCWFILYNGEGVPGQNQEIAGAGSLAVAMDSIISILHRR 122

Query: 128 LQQDGCQVVCL 138
           L+QDGC+VV L
Sbjct: 123 LKQDGCRVVAL 133
Negatively regulates the activity of members of the MAP kinase family in response to changes in the cellular environment. Has a specificity for the ERK family. Acts as negative regulator in a variety of developmental processes including cell differentiation and proliferation controlled by the Ras/ERK pathway. Suppresses the photoreceptor cell differentiation and wing vein formation. Required for proper oogenesis and early embryogenesis. Functions autonomously in a subset of photoreceptor progenitor cells in eye imaginal disks. Appears also to be required in surrounding non-neuronal cells for ommatidial patterning and photoreceptor differentiation. Plays a role in the maintenance of epithelial integrity during tracheal development.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q91Z46|DUS7_MOUSE Dual specificity protein phosphatase 7 OS=Mus musculus GN=Dusp7 PE=2 SV=4 Back     alignment and function description
>sp|Q16829|DUS7_HUMAN Dual specificity protein phosphatase 7 OS=Homo sapiens GN=DUSP7 PE=1 SV=4 Back     alignment and function description
>sp|Q9DBB1|DUS6_MOUSE Dual specificity protein phosphatase 6 OS=Mus musculus GN=Dusp6 PE=1 SV=1 Back     alignment and function description
>sp|Q16828|DUS6_HUMAN Dual specificity protein phosphatase 6 OS=Homo sapiens GN=DUSP6 PE=1 SV=2 Back     alignment and function description
>sp|Q2KJ36|DUS6_BOVIN Dual specificity protein phosphatase 6 OS=Bos taurus GN=DUSP6 PE=2 SV=1 Back     alignment and function description
>sp|Q64346|DUS6_RAT Dual specificity protein phosphatase 6 OS=Rattus norvegicus GN=Dusp6 PE=1 SV=1 Back     alignment and function description
>sp|Q9ESS0|DUS10_MOUSE Dual specificity protein phosphatase 10 OS=Mus musculus GN=Dusp10 PE=2 SV=2 Back     alignment and function description
>sp|Q9Y6W6|DUS10_HUMAN Dual specificity protein phosphatase 10 OS=Homo sapiens GN=DUSP10 PE=1 SV=1 Back     alignment and function description
>sp|Q0IID7|DUS10_BOVIN Dual specificity protein phosphatase 10 OS=Bos taurus GN=DUSP10 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
242004811 410 dual specificity protein phosphatase, pu 0.895 0.314 0.594 7e-38
193638888 421 PREDICTED: dual specificity protein phos 0.902 0.308 0.540 1e-31
157114798131 hypothetical protein AaeL_AAEL001150 [Ae 0.888 0.977 0.554 3e-31
270013985 438 hypothetical protein TcasGA2_TC012676 [T 0.784 0.257 0.581 1e-29
189241224 411 PREDICTED: similar to AGAP012237-PA [Tri 0.784 0.274 0.581 1e-29
195377581 417 GJ13512 [Drosophila virilis] gi|19415472 0.902 0.311 0.534 3e-29
170038607212 conserved hypothetical protein [Culex qu 0.798 0.542 0.606 5e-29
195127985 419 GI11809 [Drosophila mojavensis] gi|19392 0.902 0.310 0.533 7e-29
195020661 425 GH16949 [Drosophila grimshawi] gi|193898 0.895 0.303 0.513 3e-28
158300362 400 AGAP012237-PA [Anopheles gambiae str. PE 0.847 0.305 0.540 1e-27
>gi|242004811|ref|XP_002423270.1| dual specificity protein phosphatase, putative [Pediculus humanus corporis] gi|212506272|gb|EEB10532.1| dual specificity protein phosphatase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  161 bits (408), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 109/138 (78%), Gaps = 9/138 (6%)

Query: 3   MPAGE-EEFTTL-ELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSI 60
           MP  + +E+T++ ++ ++K WLLQ+LRSD  ++IILDCRS+NEY ESHIR AVNFSIPSI
Sbjct: 1   MPTSDVDEYTSIRDIRITKEWLLQQLRSDSKQIIILDCRSTNEYGESHIRQAVNFSIPSI 60

Query: 61  MLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDT 120
           MLRRL+AGKI+L+STIKC+ LKEKI+  YK  LFV+YGD      ++ D EK+  T  + 
Sbjct: 61  MLRRLSAGKIDLISTIKCKGLKEKILEGYKRDLFVIYGD------DLNDTEKNNNT-KEI 113

Query: 121 MNVLTKRLQQDGCQVVCL 138
           ++VL KRL+QDGC+VVCL
Sbjct: 114 LHVLMKRLKQDGCKVVCL 131

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193638888|ref|XP_001943978.1| PREDICTED: dual specificity protein phosphatase 7-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|157114798|ref|XP_001652427.1| hypothetical protein AaeL_AAEL001150 [Aedes aegypti] gi|108883580|gb|EAT47805.1| AAEL001150-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|270013985|gb|EFA10433.1| hypothetical protein TcasGA2_TC012676 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189241224|ref|XP_971654.2| PREDICTED: similar to AGAP012237-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195377581|ref|XP_002047567.1| GJ13512 [Drosophila virilis] gi|194154725|gb|EDW69909.1| GJ13512 [Drosophila virilis] Back     alignment and taxonomy information
>gi|170038607|ref|XP_001847140.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167882339|gb|EDS45722.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195127985|ref|XP_002008447.1| GI11809 [Drosophila mojavensis] gi|193920056|gb|EDW18923.1| GI11809 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195020661|ref|XP_001985242.1| GH16949 [Drosophila grimshawi] gi|193898724|gb|EDV97590.1| GH16949 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|158300362|ref|XP_320303.4| AGAP012237-PA [Anopheles gambiae str. PEST] gi|157013123|gb|EAA00236.5| AGAP012237-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
FB|FBgn0036844 411 Mkp3 "Mitogen-activated protei 0.881 0.309 0.496 1.8e-25
ZFIN|ZDB-GENE-030131-5457 364 dusp7 "dual specificity phosph 0.791 0.313 0.314 6.1e-12
UNIPROTKB|Q7T2L9 382 MKP3 "Dual specificity protein 0.819 0.308 0.328 2.4e-11
UNIPROTKB|E1BQ65 383 DUSP6 "Dual specificity protei 0.819 0.308 0.328 2.5e-11
UNIPROTKB|F1MFJ5 386 DUSP7 "Uncharacterized protein 0.812 0.303 0.314 6.8e-11
UNIPROTKB|F1SIY1 417 DUSP7 "Uncharacterized protein 0.812 0.280 0.314 8.1e-11
UNIPROTKB|J9NZB8 419 DUSP7 "Uncharacterized protein 0.812 0.279 0.314 8.2e-11
UNIPROTKB|Q16829 419 DUSP7 "Dual specificity protei 0.812 0.279 0.314 8.2e-11
MGI|MGI:2387100 422 Dusp7 "dual specificity phosph 0.812 0.277 0.314 8.3e-11
MGI|MGI:1914853 381 Dusp6 "dual specificity phosph 0.819 0.309 0.283 3e-10
FB|FBgn0036844 Mkp3 "Mitogen-activated protein kinase phosphatase 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 289 (106.8 bits), Expect = 1.8e-25, P = 1.8e-25
 Identities = 65/131 (49%), Positives = 85/131 (64%)

Query:    11 TTLELCVSKSWLLQELRS-DPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGK 69
             T  E C SK WL  +LRS D   LI+LDCR S+EY+ESHIR AVN  IPSI+LRRLA GK
Sbjct:     4 TEHETC-SKEWLQSQLRSLDSKDLILLDCRGSHEYSESHIRGAVNLCIPSIVLRRLAVGK 62

Query:    70 IELLSTIKCRELKEKIMNAYKDSLFVVY-GDSCMSE-VEVRDREKHCYTASDTMNVLTKR 127
             I+L STIK  ELK++I + YK   F++Y G+    +  E+             +++L +R
Sbjct:    63 IDLASTIKSPELKQRIQSGYKLCWFILYNGEGVPGQNQEIAGAGSLAVAMDSIISILHRR 122

Query:   128 LQQDGCQVVCL 138
             L+QDGC+VV L
Sbjct:   123 LKQDGCRVVAL 133
GO:0017017 "MAP kinase tyrosine/serine/threonine phosphatase activity" evidence=ISS;IBA
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=ISS;NAS
GO:0006470 "protein dephosphorylation" evidence=IDA;NAS
GO:0016791 "phosphatase activity" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0043409 "negative regulation of MAPK cascade" evidence=IMP
GO:0007474 "imaginal disc-derived wing vein specification" evidence=IMP
GO:0007428 "primary branching, open tracheal system" evidence=IMP
GO:0016337 "cell-cell adhesion" evidence=IMP
GO:0035160 "maintenance of epithelial integrity, open tracheal system" evidence=IMP
GO:0042127 "regulation of cell proliferation" evidence=IGI
GO:0002385 "mucosal immune response" evidence=IMP
GO:0000188 "inactivation of MAPK activity" evidence=IBA
GO:0005829 "cytosol" evidence=IBA
ZFIN|ZDB-GENE-030131-5457 dusp7 "dual specificity phosphatase 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q7T2L9 MKP3 "Dual specificity protein phosphatase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQ65 DUSP6 "Dual specificity protein phosphatase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MFJ5 DUSP7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIY1 DUSP7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZB8 DUSP7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q16829 DUSP7 "Dual specificity protein phosphatase 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2387100 Dusp7 "dual specificity phosphatase 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:1914853 Dusp6 "dual specificity phosphatase 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VVW5DUSK3_DROME3, ., 1, ., 3, ., 4, 80.50380.88190.3090yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
cd01446132 cd01446, DSP_MapKP, N-terminal regulatory rhodanes 2e-25
pfam00581106 pfam00581, Rhodanese, Rhodanese-like domain 2e-09
smart00450100 smart00450, RHOD, Rhodanese Homology Domain 2e-07
cd01448122 cd01448, TST_Repeat_1, Thiosulfate sulfurtransfera 3e-06
cd0015889 cd00158, RHOD, Rhodanese Homology Domain (RHOD); a 6e-04
cd01525105 cd01525, RHOD_Kc, Member of the Rhodanese Homology 6e-04
>gnl|CDD|238723 cd01446, DSP_MapKP, N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information 
 Score = 93.5 bits (233), Expect = 2e-25
 Identities = 45/123 (36%), Positives = 63/123 (51%), Gaps = 10/123 (8%)

Query: 18  SKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIK 77
             +WL   LR    RL++LDCR   EY+ SHIR AVN   P+I+ RRL  GKI L   + 
Sbjct: 3   DCAWLAALLREGGERLLLLDCRPFLEYSSSHIRGAVNVCCPTILRRRLQGGKILLQQLLS 62

Query: 78  CRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTK--RLQQDGCQV 135
           C E ++++      ++ VVY +S      +R+        S   +VL K  R  Q+GC V
Sbjct: 63  CPEDRDRLRRGESLAV-VVYDESSSDRERLRE-------DSTAESVLGKLLRKLQEGCSV 114

Query: 136 VCL 138
             L
Sbjct: 115 YLL 117

This domain is believed to determine substrate specificity by binding the substrate, such as ERK2, and activating the C-terminal catalytic domain by inducing a conformational change. This domain has homology to the Rhodanese Homology Domain. Length = 132
>gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain Back     alignment and domain information
>gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain Back     alignment and domain information
>gnl|CDD|238725 cd01448, TST_Repeat_1, Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>gnl|CDD|238783 cd01525, RHOD_Kc, Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 144
cd01446132 DSP_MapKP N-terminal regulatory rhodanese domain o 99.81
COG2897 285 SseA Rhodanese-related sulfurtransferase [Inorgani 99.67
PLN02723 320 3-mercaptopyruvate sulfurtransferase 99.66
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.65
cd01525105 RHOD_Kc Member of the Rhodanese Homology Domain su 99.64
cd01445138 TST_Repeats Thiosulfate sulfurtransferases (TST) c 99.64
PRK11493 281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 99.62
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 99.6
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 99.58
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 99.57
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 99.57
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 99.56
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), 99.55
KOG1717|consensus 343 99.55
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 99.55
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 99.53
cd01521110 RHOD_PspE2 Member of the Rhodanese Homology Domain 99.52
cd01530121 Cdc25 Cdc25 phosphatases are members of the Rhodan 99.5
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Doma 99.49
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Do 99.49
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 99.47
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rho 99.47
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 99.46
cd0152996 4RHOD_Repeats Member of the Rhodanese Homology Dom 99.45
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs a 99.44
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain 99.44
PRK00162108 glpE thiosulfate sulfurtransferase; Validated 99.43
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 99.42
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain 99.42
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 99.42
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 99.4
cd0015889 RHOD Rhodanese Homology Domain (RHOD); an alpha be 99.39
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 99.38
KOG1529|consensus 286 99.34
PLN02723320 3-mercaptopyruvate sulfurtransferase 99.29
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 99.29
PLN02160136 thiosulfate sulfurtransferase 99.24
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 99.23
PRK01415247 hypothetical protein; Validated 99.21
PRK09629 610 bifunctional thiosulfate sulfurtransferase/phospha 99.2
cd01535145 4RHOD_Repeat_4 Member of the Rhodanese Homology Do 99.2
PRK07411390 hypothetical protein; Validated 99.17
PRK11784 345 tRNA 2-selenouridine synthase; Provisional 99.16
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Vali 99.15
PRK05320257 rhodanese superfamily protein; Provisional 99.15
PRK08762 376 molybdopterin biosynthesis protein MoeB; Validated 99.12
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 99.07
KOG1530|consensus136 99.06
TIGR02981101 phageshock_pspE phage shock operon rhodanese PspE. 99.06
PRK11493281 sseA 3-mercaptopyruvate sulfurtransferase; Provisi 98.99
PRK05600370 thiamine biosynthesis protein ThiF; Validated 98.96
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 98.96
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 98.93
COG2897285 SseA Rhodanese-related sulfurtransferase [Inorgani 98.89
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 98.85
KOG3772|consensus325 98.46
COG1054308 Predicted sulfurtransferase [General function pred 98.19
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 98.18
KOG2017|consensus427 97.32
COG5105427 MIH1 Mitotic inducer, protein phosphatase [Cell di 97.09
KOG3636|consensus 669 96.39
KOG1529|consensus286 94.87
PRK00142 314 putative rhodanese-related sulfurtransferase; Prov 89.6
COG2603 334 Predicted ATPase [General function prediction only 80.26
>cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase Back     alignment and domain information 
Probab=99.81  E-value=3.2e-19  Score=126.69  Aligned_cols=117  Identities=38%  Similarity=0.602  Sum_probs=89.6

Q ss_pred             ccCHHHHHHHhccCCCCeEEEeecCcchhccCCCcCceecCCchhhHHhhhccccccccccCCHHHHHHHHhhCCCCEEE
Q psy18174         16 CVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFV   95 (144)
Q Consensus        16 ~Is~~~L~~~l~~~~~~~~IlD~R~~~~y~~~HIpgAi~~~~~~~l~~r~~~~~~~~~~~lp~~~~~~~l~~~~~~~~VV   95 (144)
                      +|+++||.++++...++++|||+|+..+|..+|||||+|++++.+..++...+......++++++.++.+... ++.+||
T Consensus         1 ~is~~~l~~~l~~~~~~~~iiDvR~~~~~~~~hI~~ai~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~-~~~~VV   79 (132)
T cd01446           1 TIDCAWLAALLREGGERLLLLDCRPFLEYSSSHIRGAVNVCCPTILRRRLQGGKILLQQLLSCPEDRDRLRRG-ESLAVV   79 (132)
T ss_pred             CcCHHHHHHHHhcCCCCEEEEECCCHHHHhhCcccCcEecChHHHHHHhhcccchhhhhhcCCHHHHHHHhcC-CCCeEE
Confidence            5899999999985225799999999999999999999999999876666554444444578888877777665 688999


Q ss_pred             EEcCCCCccccccccccccCCCccHHHHHHHHHHh---cCceeEEeecc
Q psy18174         96 VYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQ---DGCQVVCLLVL  141 (144)
Q Consensus        96 vYD~~~~~~~~g~~~~~~~~~~~~~~~~~~~~L~~---~g~~~~~l~G~  141 (144)
                      |||+. +.     .+.  .......+..++++|..   .+.++++|+||
T Consensus        80 vYd~~-~~-----~~~--~~~~~~~~~~~~~~l~~~~~~~~~v~~L~GG  120 (132)
T cd01446          80 VYDES-SS-----DRE--RLREDSTAESVLGKLLRKLQEGCSVYLLKGG  120 (132)
T ss_pred             EEeCC-Cc-----chh--hccccchHHHHHHHHHHhcCCCceEEEEcch
Confidence            99988 21     110  11234467788889987   55669999998

This domain is believed to determine substrate specificity by binding the substrate, such as ERK2, and activating the C-terminal catalytic domain by inducing a conformational change. This domain has homology to the Rhodanese Homology Domain.
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>KOG1717|consensus Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>KOG1529|consensus Back     alignment and domain information
>PLN02723 3-mercaptopyruvate sulfurtransferase Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional Back     alignment and domain information
>cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>PRK11784 tRNA 2-selenouridine synthase; Provisional Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>KOG1530|consensus Back     alignment and domain information
>TIGR02981 phageshock_pspE phage shock operon rhodanese PspE Back     alignment and domain information
>PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG3772|consensus Back     alignment and domain information
>COG1054 Predicted sulfurtransferase [General function prediction only] Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>KOG2017|consensus Back     alignment and domain information
>COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG3636|consensus Back     alignment and domain information
>KOG1529|consensus Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>COG2603 Predicted ATPase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
1hzm_A154 Structure Of Erk2 Binding Domain Of Mapk Phosphatas 4e-09
3tg1_B158 Crystal Structure Of P38alpha In Complex With A Map 9e-06
2ouc_A142 Crystal Structure Of The Map Kinase Binding Domain 9e-06
>pdb|1HZM|A Chain A, Structure Of Erk2 Binding Domain Of Mapk Phosphatase Mkp-3: Structural Insights Into Mkp-3 Activation By Erk2 Length = 154 Back     alignment and structure 
Iteration: 1

 Score = 57.0 bits (136), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 48/89 (53%), Gaps = 2/89 (2%)
Query: 14  ELCVSKS--WLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIE 71
           E+ +SK+  WL ++L     RL+++DCR    Y  SHI  A+N +IP IMLRRL  G + 
Sbjct: 13  EMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLP 72
Query: 72  LLSTIKCRELKEKIMNAYKDSLFVVYGDS 100
           + +     E +++          V+Y +S
Sbjct: 73  VRALFTRGEDRDRFTRRCGTDTVVLYDES 101
>pdb|3TG1|B Chain B, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 158 Back     alignment and structure
>pdb|2OUC|A Chain A, Crystal Structure Of The Map Kinase Binding Domain Of Mkp5 Length = 142 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 3e-23
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 7e-19
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 1e-18
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 9e-17
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 5e-12
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 1e-11
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 2e-08
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 1e-06
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 3e-06
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 8e-05
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 5e-06
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 7e-06
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 9e-06
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 9e-06
3op3_A216 M-phase inducer phosphatase 3; structural genomics 1e-05
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 1e-05
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 2e-05
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 2e-05
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 8e-05
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 8e-05
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 1e-04
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 2e-04
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 3e-04
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 3e-04
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 4e-04
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 4e-04
3olh_A 302 MST, 3-mercaptopyruvate sulfurtransferase; structu 5e-04
1rhs_A 296 Sulfur-substituted rhodanese; transferase, sulfurt 5e-04
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 8e-04
3foj_A100 Uncharacterized protein; protein SSP1007, structur 8e-04
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Length = 154 Back     alignment and structure
 Score = 87.9 bits (217), Expect = 3e-23
 Identities = 33/128 (25%), Positives = 59/128 (46%), Gaps = 7/128 (5%)

Query: 11  TTLELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKI 70
           + + +  + +WL ++L     RL+++DCR    Y  SHI  A+N +IP IMLRRL  G +
Sbjct: 12  SEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNL 71

Query: 71  ELLSTIKCRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQ 130
            + +     E +++          V+Y +S                    + +L K+L+ 
Sbjct: 72  PVRALFTRGEDRDRFTRRCGTDTVVLYDESS-------SDWNENTGGESLLGLLLKKLKD 124

Query: 131 DGCQVVCL 138
           +GC+   L
Sbjct: 125 EGCRAFYL 132
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Length = 158 Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Length = 142 Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Length = 153 Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Length = 157 Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Length = 157 Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Length = 271 Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Length = 161 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Length = 423 Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Length = 423 Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Length = 318 Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Length = 285 Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Length = 175 Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Length = 230 Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Length = 216 Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Length = 211 Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Length = 277 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Length = 280 Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Length = 302 Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Length = 296 Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
1hzm_A154 Dual specificity protein phosphatase 6; hydrolase; 99.8
3utn_X 327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 99.73
3olh_A 302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.7
3tg1_B158 Dual specificity protein phosphatase 10; kinase/rh 99.7
2ouc_A142 Dual specificity protein phosphatase 10; rhodanese 99.69
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.68
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 99.68
3foj_A100 Uncharacterized protein; protein SSP1007, structur 99.68
1e0c_A 271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.67
1urh_A 280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.66
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.64
2vsw_A153 Dual specificity protein phosphatase 16; hydrolase 99.64
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 99.63
1rhs_A 296 Sulfur-substituted rhodanese; transferase, sulfurt 99.61
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 99.61
1wv9_A94 Rhodanese homolog TT1651; CDC25, phosphatase, sulf 99.61
3ilm_A141 ALR3790 protein; rhodanese-like, NSR437H, NESG, st 99.61
3nhv_A144 BH2092 protein; alpha-beta protein, structural gen 99.61
1uar_A 285 Rhodanese; sulfurtransferase, riken structural gen 99.6
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; at 99.59
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 99.59
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 99.59
3aay_A 277 Putative thiosulfate sulfurtransferase; sulfurtran 99.59
3hix_A106 ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q 99.55
2gwf_A157 Ubiquitin carboxyl-terminal hydrolase 8; protein-p 99.55
1tq1_A129 AT5G66040, senescence-associated family protein; C 99.55
1whb_A157 KIAA0055; deubiqutinating enzyme, UBPY, structural 99.54
1okg_A 373 Possible 3-mercaptopyruvate sulfurtransferase; rho 99.53
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 99.52
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 99.5
3i2v_A127 Adenylyltransferase and sulfurtransferase MOCS3; r 99.49
2j6p_A152 SB(V)-AS(V) reductase; arsenate reductase, antimon 99.49
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.49
1t3k_A152 Arath CDC25, dual-specificity tyrosine phosphatase 99.47
1c25_A161 CDC25A; hydrolase, cell cycle phosphatase,dual spe 99.41
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 99.41
1e0c_A271 Rhodanese, sulfurtransferase; sulfur metabolism, t 99.4
2k0z_A110 Uncharacterized protein HP1203; A/B domain, struct 99.4
3op3_A216 M-phase inducer phosphatase 3; structural genomics 99.37
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 99.37
4f67_A265 UPF0176 protein LPG2838; structural genomics, PSI- 99.37
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.37
2a2k_A175 M-phase inducer phosphatase 2; dual specificity, s 99.36
2jtq_A85 Phage shock protein E; solution structure rhodanes 99.36
2eg4_A 230 Probable thiosulfate sulfurtransferase; structural 99.35
1urh_A280 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 99.33
1qb0_A211 Protein (M-phase inducer phosphatase 2 (CDC25B)); 99.33
1uar_A285 Rhodanese; sulfurtransferase, riken structural gen 99.31
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 99.3
2wlr_A 423 Putative thiosulfate sulfurtransferase YNJE; rhoda 99.28
1yt8_A 539 Thiosulfate sulfurtransferase; rhodanase domains, 99.27
1rhs_A296 Sulfur-substituted rhodanese; transferase, sulfurt 99.26
3aay_A277 Putative thiosulfate sulfurtransferase; sulfurtran 99.25
1vee_A134 Proline-rich protein family; hypothetical protein, 99.23
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 99.2
3hzu_A318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 99.19
3tp9_A474 Beta-lactamase and rhodanese domain protein; struc 99.14
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 99.11
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 99.05
2eg4_A230 Probable thiosulfate sulfurtransferase; structural 99.02
3r2u_A466 Metallo-beta-lactamase family protein; structural 98.85
1okg_A373 Possible 3-mercaptopyruvate sulfurtransferase; rho 98.82
3utn_X327 Thiosulfate sulfurtransferase TUM1; rhodanese-like 98.7
3r2u_A466 Metallo-beta-lactamase family protein; structural 98.69
2f46_A156 Hypothetical protein; structural genomics, joint c 88.61
>1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
Probab=99.80  E-value=6.3e-20  Score=131.58  Aligned_cols=126  Identities=29%  Similarity=0.549  Sum_probs=91.0

Q ss_pred             ccccc-CCCccCHHHHHHHhccCCCCeEEEeecCcchhccCCCcCceecCCchhhHHhhhccccccccccCCHHHHHHHH
Q psy18174          8 EEFTT-LELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIM   86 (144)
Q Consensus         8 ~~~~~-~~~~Is~~~L~~~l~~~~~~~~IlD~R~~~~y~~~HIpgAi~~~~~~~l~~r~~~~~~~~~~~lp~~~~~~~l~   86 (144)
                      ..|.+ +...|+++||.++++....+++|||||+..+|..||||||+|++++.++.++...+..++.+.+|+++.++.+.
T Consensus         8 ~~~~~~~~~~is~~~l~~~l~~~~~~~~liDvR~~~ey~~gHIpgAinip~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~   87 (154)
T 1hzm_A            8 VPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPVRALFTRGEDRDRFT   87 (154)
T ss_dssp             SSSSSCCSSBSCCCCHHHHHHHCSSSCEEECCSTTHHHHHHTSSSCCCCCCSSHHHHTBCCSCCCTTTTSTTSHHHHHHH
T ss_pred             cccccccccccCHHHHHHHHhCCCCCEEEEEcCCHHHHhhccccCceEeCccHHHHhhhhcCcccHHHhCCCHHHHHHHh
Confidence            34555 45689999999999842137999999999999999999999999988765554334446677888776666665


Q ss_pred             hhCCCCEEEEEcCCCCccccccccccccCC-CccHHHHHHHHHHhcCceeEEeecc
Q psy18174         87 NAYKDSLFVVYGDSCMSEVEVRDREKHCYT-ASDTMNVLTKRLQQDGCQVVCLLVL  141 (144)
Q Consensus        87 ~~~~~~~VVvYD~~~~~~~~g~~~~~~~~~-~~~~~~~~~~~L~~~g~~~~~l~G~  141 (144)
                      ...++++|||||+.+.      .++.  .. +...+..++++|...||++++|+||
T Consensus        88 ~~~~~~~iVvyc~~g~------~~~~--~~~aa~~~~~~l~~l~~~G~~v~~L~GG  135 (154)
T 1hzm_A           88 RRCGTDTVVLYDESSS------DWNE--NTGGESLLGLLLKKLKDEGCRAFYLEGG  135 (154)
T ss_dssp             HSTTSSCEEECCCSSS------SSCS--CSSCCSHHHHHHHHHHHTTCCCEECCCC
T ss_pred             ccCCCCeEEEEeCCCC------cccc--ccccchHHHHHHHHHHHCCCceEEEcCh
Confidence            4445779999998722      1100  00 1234566777887789999999998
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Back     alignment and structure
>2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Back     alignment and structure
>3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Back     alignment and structure
>2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Back     alignment and structure
>1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Back     alignment and structure
>2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Back     alignment and structure
>1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Back     alignment and structure
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Back     alignment and structure
>3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Back     alignment and structure
>1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure
>2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Back     alignment and structure
>1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Back     alignment and structure
>1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Back     alignment and structure
>3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 Back     alignment and structure
>3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 144
d1hzma_154 c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat 2e-19
d2gwfa1135 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h 1e-07
d1c25a_161 c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 8e-06
d1e0ca1135 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter 4e-04
d1ymka1174 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) 5e-04
d1okga1156 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransf 0.001
d1rhsa1149 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [Ta 0.003
d1uara1143 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus ther 0.004
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Cell cycle control phosphatase, catalytic domain
domain: Erk2 binding domain of Mapk phosphatase mkp-3
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 76.8 bits (188), Expect = 2e-19
 Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 7/122 (5%)

Query: 17  VSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTI 76
            + +WL ++L     RL+++DCR    Y  SHI  A+N +IP IMLRRL  G + + +  
Sbjct: 18  KTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPVRALF 77

Query: 77  KCRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQDGCQVV 136
              E +++          V+Y +S     E              + +L K+L+ +GC+  
Sbjct: 78  TRGEDRDRFTRRCGTDTVVLYDESSSDWNE-------NTGGESLLGLLLKKLKDEGCRAF 130

Query: 137 CL 138
            L
Sbjct: 131 YL 132
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135 Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 156 Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 149 Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 143 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
d1hzma_154 Erk2 binding domain of Mapk phosphatase mkp-3 {Hum 99.88
d1urha1147 3-mercaptopyruvate sulfurtransferase {Escherichia 99.82
d1rhsa1149 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.79
d1okga1156 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.79
d1uara1143 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.77
d1e0ca1135 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.72
d2gwfa1135 Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum 99.71
d1e0ca2136 Sulfurtransferase {Azotobacter vinelandii [TaxId: 99.63
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.61
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 99.6
d1yt8a2101 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.59
d1yt8a1136 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.58
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 99.54
d1c25a_161 CDC25a {Human (Homo sapiens) [TaxId: 9606]} 99.53
d1yt8a3157 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 99.52
d1ymka1174 CDC25b {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1t3ka_132 Dual specificity phosphatase Cdc25 {Thale cress (A 99.5
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 99.46
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 99.4
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 99.35
d1uara2141 Sulfurtransferase {Thermus thermophilus [TaxId: 27 99.28
d1okga2139 3-mercaptopyruvate sulfurtransferase {Leishmania m 99.15
>d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Rhodanese/Cell cycle control phosphatase
superfamily: Rhodanese/Cell cycle control phosphatase
family: Cell cycle control phosphatase, catalytic domain
domain: Erk2 binding domain of Mapk phosphatase mkp-3
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.88  E-value=2e-23  Score=148.76  Aligned_cols=122  Identities=28%  Similarity=0.531  Sum_probs=101.2

Q ss_pred             CCCccCHHHHHHHhccCCCCeEEEeecCcchhccCCCcCceecCCchhhHHhhhccccccccccCCHHHHHHHHhhCCCC
Q psy18174         13 LELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDS   92 (144)
Q Consensus        13 ~~~~Is~~~L~~~l~~~~~~~~IlD~R~~~~y~~~HIpgAi~~~~~~~l~~r~~~~~~~~~~~lp~~~~~~~l~~~~~~~   92 (144)
                      +...||++||+++|+..+++++|||||+..+|+.||||||+|++++.++.+|...+...+.+.+++.+.+..+.....++
T Consensus        14 ~~~~~s~e~L~~~l~~~~~~~lilDvR~~~ey~~~HI~gAini~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   93 (154)
T d1hzma_          14 MAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPVRALFTRGEDRDRFTRRCGTD   93 (154)
T ss_dssp             CSSBSCCCCHHHHHHHCSSSCEEECCSTTHHHHHHTSSSCCCCCCSSHHHHTBCCSCCCTTTTSTTSHHHHHHHHSTTSS
T ss_pred             ccCccCHHHHHHHHhcCCCCEEEEECCCHHHHhcCCCCCCcccCcHHHHhhhccCCcccccccCCcHHHHHHHhhcCCCC
Confidence            45579999999999865678999999999999999999999999999888888777778888888887777776665688


Q ss_pred             EEEEEcCCCCccccccccccccCCCccHHHHHHHHHHhcCceeEEeecc
Q psy18174         93 LFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQDGCQVVCLLVL  141 (144)
Q Consensus        93 ~VVvYD~~~~~~~~g~~~~~~~~~~~~~~~~~~~~L~~~g~~~~~l~G~  141 (144)
                      +||+||+.+.      .+. ........+..++++|...|+++++|+||
T Consensus        94 ~VVvYd~~~~------~~~-~~~~~~~~~~~l~~~l~~~~~~v~iL~GG  135 (154)
T d1hzma_          94 TVVLYDESSS------DWN-ENTGGESLLGLLLKKLKDEGCRAFYLEGG  135 (154)
T ss_dssp             CEEECCCSSS------SSC-SCSSCCSHHHHHHHHHHHTTCCCEECCCC
T ss_pred             eEEEEcCCCc------hhh-hhHHHHHHHHHHHHHHHhcCCeEEEEeCc
Confidence            9999998722      121 12344568889999999999999999998
>d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure