Psyllid ID: psy18174
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 144 | ||||||
| 242004811 | 410 | dual specificity protein phosphatase, pu | 0.895 | 0.314 | 0.594 | 7e-38 | |
| 193638888 | 421 | PREDICTED: dual specificity protein phos | 0.902 | 0.308 | 0.540 | 1e-31 | |
| 157114798 | 131 | hypothetical protein AaeL_AAEL001150 [Ae | 0.888 | 0.977 | 0.554 | 3e-31 | |
| 270013985 | 438 | hypothetical protein TcasGA2_TC012676 [T | 0.784 | 0.257 | 0.581 | 1e-29 | |
| 189241224 | 411 | PREDICTED: similar to AGAP012237-PA [Tri | 0.784 | 0.274 | 0.581 | 1e-29 | |
| 195377581 | 417 | GJ13512 [Drosophila virilis] gi|19415472 | 0.902 | 0.311 | 0.534 | 3e-29 | |
| 170038607 | 212 | conserved hypothetical protein [Culex qu | 0.798 | 0.542 | 0.606 | 5e-29 | |
| 195127985 | 419 | GI11809 [Drosophila mojavensis] gi|19392 | 0.902 | 0.310 | 0.533 | 7e-29 | |
| 195020661 | 425 | GH16949 [Drosophila grimshawi] gi|193898 | 0.895 | 0.303 | 0.513 | 3e-28 | |
| 158300362 | 400 | AGAP012237-PA [Anopheles gambiae str. PE | 0.847 | 0.305 | 0.540 | 1e-27 |
| >gi|242004811|ref|XP_002423270.1| dual specificity protein phosphatase, putative [Pediculus humanus corporis] gi|212506272|gb|EEB10532.1| dual specificity protein phosphatase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 161 bits (408), Expect = 7e-38, Method: Compositional matrix adjust.
Identities = 82/138 (59%), Positives = 109/138 (78%), Gaps = 9/138 (6%)
Query: 3 MPAGE-EEFTTL-ELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSI 60
MP + +E+T++ ++ ++K WLLQ+LRSD ++IILDCRS+NEY ESHIR AVNFSIPSI
Sbjct: 1 MPTSDVDEYTSIRDIRITKEWLLQQLRSDSKQIIILDCRSTNEYGESHIRQAVNFSIPSI 60
Query: 61 MLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDT 120
MLRRL+AGKI+L+STIKC+ LKEKI+ YK LFV+YGD ++ D EK+ T +
Sbjct: 61 MLRRLSAGKIDLISTIKCKGLKEKILEGYKRDLFVIYGD------DLNDTEKNNNT-KEI 113
Query: 121 MNVLTKRLQQDGCQVVCL 138
++VL KRL+QDGC+VVCL
Sbjct: 114 LHVLMKRLKQDGCKVVCL 131
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|193638888|ref|XP_001943978.1| PREDICTED: dual specificity protein phosphatase 7-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|157114798|ref|XP_001652427.1| hypothetical protein AaeL_AAEL001150 [Aedes aegypti] gi|108883580|gb|EAT47805.1| AAEL001150-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|270013985|gb|EFA10433.1| hypothetical protein TcasGA2_TC012676 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189241224|ref|XP_971654.2| PREDICTED: similar to AGAP012237-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|195377581|ref|XP_002047567.1| GJ13512 [Drosophila virilis] gi|194154725|gb|EDW69909.1| GJ13512 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|170038607|ref|XP_001847140.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167882339|gb|EDS45722.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|195127985|ref|XP_002008447.1| GI11809 [Drosophila mojavensis] gi|193920056|gb|EDW18923.1| GI11809 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|195020661|ref|XP_001985242.1| GH16949 [Drosophila grimshawi] gi|193898724|gb|EDV97590.1| GH16949 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|158300362|ref|XP_320303.4| AGAP012237-PA [Anopheles gambiae str. PEST] gi|157013123|gb|EAA00236.5| AGAP012237-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 144 | ||||||
| FB|FBgn0036844 | 411 | Mkp3 "Mitogen-activated protei | 0.881 | 0.309 | 0.496 | 1.8e-25 | |
| ZFIN|ZDB-GENE-030131-5457 | 364 | dusp7 "dual specificity phosph | 0.791 | 0.313 | 0.314 | 6.1e-12 | |
| UNIPROTKB|Q7T2L9 | 382 | MKP3 "Dual specificity protein | 0.819 | 0.308 | 0.328 | 2.4e-11 | |
| UNIPROTKB|E1BQ65 | 383 | DUSP6 "Dual specificity protei | 0.819 | 0.308 | 0.328 | 2.5e-11 | |
| UNIPROTKB|F1MFJ5 | 386 | DUSP7 "Uncharacterized protein | 0.812 | 0.303 | 0.314 | 6.8e-11 | |
| UNIPROTKB|F1SIY1 | 417 | DUSP7 "Uncharacterized protein | 0.812 | 0.280 | 0.314 | 8.1e-11 | |
| UNIPROTKB|J9NZB8 | 419 | DUSP7 "Uncharacterized protein | 0.812 | 0.279 | 0.314 | 8.2e-11 | |
| UNIPROTKB|Q16829 | 419 | DUSP7 "Dual specificity protei | 0.812 | 0.279 | 0.314 | 8.2e-11 | |
| MGI|MGI:2387100 | 422 | Dusp7 "dual specificity phosph | 0.812 | 0.277 | 0.314 | 8.3e-11 | |
| MGI|MGI:1914853 | 381 | Dusp6 "dual specificity phosph | 0.819 | 0.309 | 0.283 | 3e-10 |
| FB|FBgn0036844 Mkp3 "Mitogen-activated protein kinase phosphatase 3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 289 (106.8 bits), Expect = 1.8e-25, P = 1.8e-25
Identities = 65/131 (49%), Positives = 85/131 (64%)
Query: 11 TTLELCVSKSWLLQELRS-DPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGK 69
T E C SK WL +LRS D LI+LDCR S+EY+ESHIR AVN IPSI+LRRLA GK
Sbjct: 4 TEHETC-SKEWLQSQLRSLDSKDLILLDCRGSHEYSESHIRGAVNLCIPSIVLRRLAVGK 62
Query: 70 IELLSTIKCRELKEKIMNAYKDSLFVVY-GDSCMSE-VEVRDREKHCYTASDTMNVLTKR 127
I+L STIK ELK++I + YK F++Y G+ + E+ +++L +R
Sbjct: 63 IDLASTIKSPELKQRIQSGYKLCWFILYNGEGVPGQNQEIAGAGSLAVAMDSIISILHRR 122
Query: 128 LQQDGCQVVCL 138
L+QDGC+VV L
Sbjct: 123 LKQDGCRVVAL 133
|
|
| ZFIN|ZDB-GENE-030131-5457 dusp7 "dual specificity phosphatase 7" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7T2L9 MKP3 "Dual specificity protein phosphatase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BQ65 DUSP6 "Dual specificity protein phosphatase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MFJ5 DUSP7 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SIY1 DUSP7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NZB8 DUSP7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q16829 DUSP7 "Dual specificity protein phosphatase 7" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2387100 Dusp7 "dual specificity phosphatase 7" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1914853 Dusp6 "dual specificity phosphatase 6" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 144 | |||
| cd01446 | 132 | cd01446, DSP_MapKP, N-terminal regulatory rhodanes | 2e-25 | |
| pfam00581 | 106 | pfam00581, Rhodanese, Rhodanese-like domain | 2e-09 | |
| smart00450 | 100 | smart00450, RHOD, Rhodanese Homology Domain | 2e-07 | |
| cd01448 | 122 | cd01448, TST_Repeat_1, Thiosulfate sulfurtransfera | 3e-06 | |
| cd00158 | 89 | cd00158, RHOD, Rhodanese Homology Domain (RHOD); a | 6e-04 | |
| cd01525 | 105 | cd01525, RHOD_Kc, Member of the Rhodanese Homology | 6e-04 |
| >gnl|CDD|238723 cd01446, DSP_MapKP, N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase | Back alignment and domain information |
|---|
Score = 93.5 bits (233), Expect = 2e-25
Identities = 45/123 (36%), Positives = 63/123 (51%), Gaps = 10/123 (8%)
Query: 18 SKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIK 77
+WL LR RL++LDCR EY+ SHIR AVN P+I+ RRL GKI L +
Sbjct: 3 DCAWLAALLREGGERLLLLDCRPFLEYSSSHIRGAVNVCCPTILRRRLQGGKILLQQLLS 62
Query: 78 CRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTK--RLQQDGCQV 135
C E ++++ ++ VVY +S +R+ S +VL K R Q+GC V
Sbjct: 63 CPEDRDRLRRGESLAV-VVYDESSSDRERLRE-------DSTAESVLGKLLRKLQEGCSV 114
Query: 136 VCL 138
L
Sbjct: 115 YLL 117
|
This domain is believed to determine substrate specificity by binding the substrate, such as ERK2, and activating the C-terminal catalytic domain by inducing a conformational change. This domain has homology to the Rhodanese Homology Domain. Length = 132 |
| >gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >gnl|CDD|238725 cd01448, TST_Repeat_1, Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >gnl|CDD|238783 cd01525, RHOD_Kc, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 144 | |||
| cd01446 | 132 | DSP_MapKP N-terminal regulatory rhodanese domain o | 99.81 | |
| COG2897 | 285 | SseA Rhodanese-related sulfurtransferase [Inorgani | 99.67 | |
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 99.66 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 99.65 | |
| cd01525 | 105 | RHOD_Kc Member of the Rhodanese Homology Domain su | 99.64 | |
| cd01445 | 138 | TST_Repeats Thiosulfate sulfurtransferases (TST) c | 99.64 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 99.62 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 99.6 | |
| cd01534 | 95 | 4RHOD_Repeat_3 Member of the Rhodanese Homology Do | 99.58 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 99.57 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 99.57 | |
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 99.56 | |
| cd01449 | 118 | TST_Repeat_2 Thiosulfate sulfurtransferase (TST), | 99.55 | |
| KOG1717|consensus | 343 | 99.55 | ||
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 99.55 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 99.53 | |
| cd01521 | 110 | RHOD_PspE2 Member of the Rhodanese Homology Domain | 99.52 | |
| cd01530 | 121 | Cdc25 Cdc25 phosphatases are members of the Rhodan | 99.5 | |
| cd01519 | 106 | RHOD_HSP67B2 Member of the Rhodanese Homology Doma | 99.49 | |
| cd01524 | 90 | RHOD_Pyr_redox Member of the Rhodanese Homology Do | 99.49 | |
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 99.47 | |
| cd01447 | 103 | Polysulfide_ST Polysulfide-sulfurtransferase - Rho | 99.47 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 99.46 | |
| cd01529 | 96 | 4RHOD_Repeats Member of the Rhodanese Homology Dom | 99.45 | |
| cd01444 | 96 | GlpE_ST GlpE sulfurtransferase (ST) and homologs a | 99.44 | |
| cd01527 | 99 | RHOD_YgaP Member of the Rhodanese Homology Domain | 99.44 | |
| PRK00162 | 108 | glpE thiosulfate sulfurtransferase; Validated | 99.43 | |
| smart00450 | 100 | RHOD Rhodanese Homology Domain. An alpha beta fold | 99.42 | |
| cd01526 | 122 | RHOD_ThiF Member of the Rhodanese Homology Domain | 99.42 | |
| TIGR03865 | 162 | PQQ_CXXCW PQQ-dependent catabolism-associated CXXC | 99.42 | |
| cd01443 | 113 | Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda | 99.4 | |
| cd00158 | 89 | RHOD Rhodanese Homology Domain (RHOD); an alpha be | 99.39 | |
| cd01531 | 113 | Acr2p Eukaryotic arsenate resistance proteins are | 99.38 | |
| KOG1529|consensus | 286 | 99.34 | ||
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 99.29 | |
| cd01532 | 92 | 4RHOD_Repeat_1 Member of the Rhodanese Homology Do | 99.29 | |
| PLN02160 | 136 | thiosulfate sulfurtransferase | 99.24 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 99.23 | |
| PRK01415 | 247 | hypothetical protein; Validated | 99.21 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 99.2 | |
| cd01535 | 145 | 4RHOD_Repeat_4 Member of the Rhodanese Homology Do | 99.2 | |
| PRK07411 | 390 | hypothetical protein; Validated | 99.17 | |
| PRK11784 | 345 | tRNA 2-selenouridine synthase; Provisional | 99.16 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 99.15 | |
| PRK05320 | 257 | rhodanese superfamily protein; Provisional | 99.15 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 99.12 | |
| PRK10287 | 104 | thiosulfate:cyanide sulfurtransferase; Provisional | 99.07 | |
| KOG1530|consensus | 136 | 99.06 | ||
| TIGR02981 | 101 | phageshock_pspE phage shock operon rhodanese PspE. | 99.06 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 98.99 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 98.96 | |
| TIGR03167 | 311 | tRNA_sel_U_synt tRNA 2-selenouridine synthase. The | 98.96 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 98.93 | |
| COG2897 | 285 | SseA Rhodanese-related sulfurtransferase [Inorgani | 98.89 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 98.85 | |
| KOG3772|consensus | 325 | 98.46 | ||
| COG1054 | 308 | Predicted sulfurtransferase [General function pred | 98.19 | |
| PRK01269 | 482 | tRNA s(4)U8 sulfurtransferase; Provisional | 98.18 | |
| KOG2017|consensus | 427 | 97.32 | ||
| COG5105 | 427 | MIH1 Mitotic inducer, protein phosphatase [Cell di | 97.09 | |
| KOG3636|consensus | 669 | 96.39 | ||
| KOG1529|consensus | 286 | 94.87 | ||
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 89.6 | |
| COG2603 | 334 | Predicted ATPase [General function prediction only | 80.26 |
| >cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase | Back alignment and domain information |
|---|
Probab=99.81 E-value=3.2e-19 Score=126.69 Aligned_cols=117 Identities=38% Similarity=0.602 Sum_probs=89.6
Q ss_pred ccCHHHHHHHhccCCCCeEEEeecCcchhccCCCcCceecCCchhhHHhhhccccccccccCCHHHHHHHHhhCCCCEEE
Q psy18174 16 CVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDSLFV 95 (144)
Q Consensus 16 ~Is~~~L~~~l~~~~~~~~IlD~R~~~~y~~~HIpgAi~~~~~~~l~~r~~~~~~~~~~~lp~~~~~~~l~~~~~~~~VV 95 (144)
+|+++||.++++...++++|||+|+..+|..+|||||+|++++.+..++...+......++++++.++.+... ++.+||
T Consensus 1 ~is~~~l~~~l~~~~~~~~iiDvR~~~~~~~~hI~~ai~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~-~~~~VV 79 (132)
T cd01446 1 TIDCAWLAALLREGGERLLLLDCRPFLEYSSSHIRGAVNVCCPTILRRRLQGGKILLQQLLSCPEDRDRLRRG-ESLAVV 79 (132)
T ss_pred CcCHHHHHHHHhcCCCCEEEEECCCHHHHhhCcccCcEecChHHHHHHhhcccchhhhhhcCCHHHHHHHhcC-CCCeEE
Confidence 5899999999985225799999999999999999999999999876666554444444578888877777665 688999
Q ss_pred EEcCCCCccccccccccccCCCccHHHHHHHHHHh---cCceeEEeecc
Q psy18174 96 VYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQ---DGCQVVCLLVL 141 (144)
Q Consensus 96 vYD~~~~~~~~g~~~~~~~~~~~~~~~~~~~~L~~---~g~~~~~l~G~ 141 (144)
|||+. +. .+. .......+..++++|.. .+.++++|+||
T Consensus 80 vYd~~-~~-----~~~--~~~~~~~~~~~~~~l~~~~~~~~~v~~L~GG 120 (132)
T cd01446 80 VYDES-SS-----DRE--RLREDSTAESVLGKLLRKLQEGCSVYLLKGG 120 (132)
T ss_pred EEeCC-Cc-----chh--hccccchHHHHHHHHHHhcCCCceEEEEcch
Confidence 99988 21 110 11234467788889987 55669999998
|
This domain is believed to determine substrate specificity by binding the substrate, such as ERK2, and activating the C-terminal catalytic domain by inducing a conformational change. This domain has homology to the Rhodanese Homology Domain. |
| >COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >KOG1717|consensus | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK00162 glpE thiosulfate sulfurtransferase; Validated | Back alignment and domain information |
|---|
| >smart00450 RHOD Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein | Back alignment and domain information |
|---|
| >cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily | Back alignment and domain information |
|---|
| >cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >KOG1529|consensus | Back alignment and domain information |
|---|
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
| >cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11784 tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >PRK05320 rhodanese superfamily protein; Provisional | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1530|consensus | Back alignment and domain information |
|---|
| >TIGR02981 phageshock_pspE phage shock operon rhodanese PspE | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3772|consensus | Back alignment and domain information |
|---|
| >COG1054 Predicted sulfurtransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2017|consensus | Back alignment and domain information |
|---|
| >COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3636|consensus | Back alignment and domain information |
|---|
| >KOG1529|consensus | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >COG2603 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 144 | ||||
| 1hzm_A | 154 | Structure Of Erk2 Binding Domain Of Mapk Phosphatas | 4e-09 | ||
| 3tg1_B | 158 | Crystal Structure Of P38alpha In Complex With A Map | 9e-06 | ||
| 2ouc_A | 142 | Crystal Structure Of The Map Kinase Binding Domain | 9e-06 |
| >pdb|1HZM|A Chain A, Structure Of Erk2 Binding Domain Of Mapk Phosphatase Mkp-3: Structural Insights Into Mkp-3 Activation By Erk2 Length = 154 | Back alignment and structure |
|
| >pdb|3TG1|B Chain B, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 158 | Back alignment and structure |
| >pdb|2OUC|A Chain A, Crystal Structure Of The Map Kinase Binding Domain Of Mkp5 Length = 142 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 144 | |||
| 1hzm_A | 154 | Dual specificity protein phosphatase 6; hydrolase; | 3e-23 | |
| 3tg1_B | 158 | Dual specificity protein phosphatase 10; kinase/rh | 7e-19 | |
| 2ouc_A | 142 | Dual specificity protein phosphatase 10; rhodanese | 1e-18 | |
| 2vsw_A | 153 | Dual specificity protein phosphatase 16; hydrolase | 9e-17 | |
| 1whb_A | 157 | KIAA0055; deubiqutinating enzyme, UBPY, structural | 5e-12 | |
| 2gwf_A | 157 | Ubiquitin carboxyl-terminal hydrolase 8; protein-p | 1e-11 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 2e-08 | |
| 1c25_A | 161 | CDC25A; hydrolase, cell cycle phosphatase,dual spe | 1e-06 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 3e-06 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 8e-05 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 5e-06 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 7e-06 | |
| 2a2k_A | 175 | M-phase inducer phosphatase 2; dual specificity, s | 9e-06 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 9e-06 | |
| 3op3_A | 216 | M-phase inducer phosphatase 3; structural genomics | 1e-05 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 1e-05 | |
| 1qb0_A | 211 | Protein (M-phase inducer phosphatase 2 (CDC25B)); | 2e-05 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 2e-05 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 8e-05 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 8e-05 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 1e-04 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 2e-04 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 3e-04 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 3e-04 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 4e-04 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 4e-04 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 5e-04 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 5e-04 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 8e-04 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 8e-04 |
| >1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 Length = 154 | Back alignment and structure |
|---|
Score = 87.9 bits (217), Expect = 3e-23
Identities = 33/128 (25%), Positives = 59/128 (46%), Gaps = 7/128 (5%)
Query: 11 TTLELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKI 70
+ + + + +WL ++L RL+++DCR Y SHI A+N +IP IMLRRL G +
Sbjct: 12 SEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNL 71
Query: 71 ELLSTIKCRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQ 130
+ + E +++ V+Y +S + +L K+L+
Sbjct: 72 PVRALFTRGEDRDRFTRRCGTDTVVLYDESS-------SDWNENTGGESLLGLLLKKLKD 124
Query: 131 DGCQVVCL 138
+GC+ L
Sbjct: 125 EGCRAFYL 132
|
| >3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} Length = 158 | Back alignment and structure |
|---|
| >2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} Length = 142 | Back alignment and structure |
|---|
| >2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A Length = 153 | Back alignment and structure |
|---|
| >1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 Length = 157 | Back alignment and structure |
|---|
| >2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 Length = 157 | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Length = 271 | Back alignment and structure |
|---|
| >1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Length = 161 | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Length = 423 | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Length = 423 | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Length = 318 | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Length = 285 | Back alignment and structure |
|---|
| >2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A Length = 175 | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A Length = 230 | Back alignment and structure |
|---|
| >3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} Length = 216 | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 | Back alignment and structure |
|---|
| >1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A Length = 211 | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A Length = 277 | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 Length = 280 | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Length = 302 | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A Length = 296 | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 144 | |||
| 1hzm_A | 154 | Dual specificity protein phosphatase 6; hydrolase; | 99.8 | |
| 3utn_X | 327 | Thiosulfate sulfurtransferase TUM1; rhodanese-like | 99.73 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 99.7 | |
| 3tg1_B | 158 | Dual specificity protein phosphatase 10; kinase/rh | 99.7 | |
| 2ouc_A | 142 | Dual specificity protein phosphatase 10; rhodanese | 99.69 | |
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.68 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.68 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 99.68 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 99.67 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 99.66 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 99.64 | |
| 2vsw_A | 153 | Dual specificity protein phosphatase 16; hydrolase | 99.64 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 99.63 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 99.61 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 99.61 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 99.61 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 99.61 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 99.61 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 99.6 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 99.59 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 99.59 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 99.59 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 99.59 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 99.55 | |
| 2gwf_A | 157 | Ubiquitin carboxyl-terminal hydrolase 8; protein-p | 99.55 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 99.55 | |
| 1whb_A | 157 | KIAA0055; deubiqutinating enzyme, UBPY, structural | 99.54 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 99.53 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 99.52 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 99.5 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 99.49 | |
| 2j6p_A | 152 | SB(V)-AS(V) reductase; arsenate reductase, antimon | 99.49 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 99.49 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 99.47 | |
| 1c25_A | 161 | CDC25A; hydrolase, cell cycle phosphatase,dual spe | 99.41 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 99.41 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 99.4 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 99.4 | |
| 3op3_A | 216 | M-phase inducer phosphatase 3; structural genomics | 99.37 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 99.37 | |
| 4f67_A | 265 | UPF0176 protein LPG2838; structural genomics, PSI- | 99.37 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 99.37 | |
| 2a2k_A | 175 | M-phase inducer phosphatase 2; dual specificity, s | 99.36 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 99.36 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 99.35 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 99.33 | |
| 1qb0_A | 211 | Protein (M-phase inducer phosphatase 2 (CDC25B)); | 99.33 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 99.31 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 99.3 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 99.28 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 99.27 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 99.26 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 99.25 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 99.23 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 99.2 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 99.19 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 99.14 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 99.11 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 99.05 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 99.02 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 98.85 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 98.82 | |
| 3utn_X | 327 | Thiosulfate sulfurtransferase TUM1; rhodanese-like | 98.7 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 98.69 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 88.61 |
| >1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
Probab=99.80 E-value=6.3e-20 Score=131.58 Aligned_cols=126 Identities=29% Similarity=0.549 Sum_probs=91.0
Q ss_pred ccccc-CCCccCHHHHHHHhccCCCCeEEEeecCcchhccCCCcCceecCCchhhHHhhhccccccccccCCHHHHHHHH
Q psy18174 8 EEFTT-LELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIM 86 (144)
Q Consensus 8 ~~~~~-~~~~Is~~~L~~~l~~~~~~~~IlD~R~~~~y~~~HIpgAi~~~~~~~l~~r~~~~~~~~~~~lp~~~~~~~l~ 86 (144)
..|.+ +...|+++||.++++....+++|||||+..+|..||||||+|++++.++.++...+..++.+.+|+++.++.+.
T Consensus 8 ~~~~~~~~~~is~~~l~~~l~~~~~~~~liDvR~~~ey~~gHIpgAinip~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~ 87 (154)
T 1hzm_A 8 VPFASEMAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPVRALFTRGEDRDRFT 87 (154)
T ss_dssp SSSSSCCSSBSCCCCHHHHHHHCSSSCEEECCSTTHHHHHHTSSSCCCCCCSSHHHHTBCCSCCCTTTTSTTSHHHHHHH
T ss_pred cccccccccccCHHHHHHHHhCCCCCEEEEEcCCHHHHhhccccCceEeCccHHHHhhhhcCcccHHHhCCCHHHHHHHh
Confidence 34555 45689999999999842137999999999999999999999999988765554334446677888776666665
Q ss_pred hhCCCCEEEEEcCCCCccccccccccccCC-CccHHHHHHHHHHhcCceeEEeecc
Q psy18174 87 NAYKDSLFVVYGDSCMSEVEVRDREKHCYT-ASDTMNVLTKRLQQDGCQVVCLLVL 141 (144)
Q Consensus 87 ~~~~~~~VVvYD~~~~~~~~g~~~~~~~~~-~~~~~~~~~~~L~~~g~~~~~l~G~ 141 (144)
...++++|||||+.+. .++. .. +...+..++++|...||++++|+||
T Consensus 88 ~~~~~~~iVvyc~~g~------~~~~--~~~aa~~~~~~l~~l~~~G~~v~~L~GG 135 (154)
T 1hzm_A 88 RRCGTDTVVLYDESSS------DWNE--NTGGESLLGLLLKKLKDEGCRAFYLEGG 135 (154)
T ss_dssp HSTTSSCEEECCCSSS------SSCS--CSSCCSHHHHHHHHHHHTTCCCEECCCC
T ss_pred ccCCCCeEEEEeCCCC------cccc--ccccchHHHHHHHHHHHCCCceEEEcCh
Confidence 4445779999998722 1100 00 1234566777887789999999998
|
| >3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} | Back alignment and structure |
|---|
| >2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A | Back alignment and structure |
|---|
| >2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* | Back alignment and structure |
|---|
| >4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 | Back alignment and structure |
|---|
| >3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 144 | ||||
| d1hzma_ | 154 | c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat | 2e-19 | |
| d2gwfa1 | 135 | c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h | 1e-07 | |
| d1c25a_ | 161 | c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: | 8e-06 | |
| d1e0ca1 | 135 | c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter | 4e-04 | |
| d1ymka1 | 174 | c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) | 5e-04 | |
| d1okga1 | 156 | c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransf | 0.001 | |
| d1rhsa1 | 149 | c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [Ta | 0.003 | |
| d1uara1 | 143 | c.46.1.2 (A:2-144) Sulfurtransferase {Thermus ther | 0.004 |
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Rhodanese/Cell cycle control phosphatase superfamily: Rhodanese/Cell cycle control phosphatase family: Cell cycle control phosphatase, catalytic domain domain: Erk2 binding domain of Mapk phosphatase mkp-3 species: Human (Homo sapiens) [TaxId: 9606]
Score = 76.8 bits (188), Expect = 2e-19
Identities = 34/122 (27%), Positives = 57/122 (46%), Gaps = 7/122 (5%)
Query: 17 VSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTI 76
+ +WL ++L RL+++DCR Y SHI A+N +IP IMLRRL G + + +
Sbjct: 18 KTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPVRALF 77
Query: 77 KCRELKEKIMNAYKDSLFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQDGCQVV 136
E +++ V+Y +S E + +L K+L+ +GC+
Sbjct: 78 TRGEDRDRFTRRCGTDTVVLYDESSSDWNE-------NTGGESLLGLLLKKLKDEGCRAF 130
Query: 137 CL 138
L
Sbjct: 131 YL 132
|
| >d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
| >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135 | Back information, alignment and structure |
|---|
| >d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 156 | Back information, alignment and structure |
|---|
| >d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 149 | Back information, alignment and structure |
|---|
| >d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 143 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 144 | |||
| d1hzma_ | 154 | Erk2 binding domain of Mapk phosphatase mkp-3 {Hum | 99.88 | |
| d1urha1 | 147 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 99.82 | |
| d1rhsa1 | 149 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 99.79 | |
| d1okga1 | 156 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 99.79 | |
| d1uara1 | 143 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 99.77 | |
| d1e0ca1 | 135 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 99.72 | |
| d2gwfa1 | 135 | Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum | 99.71 | |
| d1e0ca2 | 136 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 99.63 | |
| d1yt8a4 | 130 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.61 | |
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 99.6 | |
| d1yt8a2 | 101 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.59 | |
| d1yt8a1 | 136 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.58 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 99.54 | |
| d1c25a_ | 161 | CDC25a {Human (Homo sapiens) [TaxId: 9606]} | 99.53 | |
| d1yt8a3 | 157 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.52 | |
| d1ymka1 | 174 | CDC25b {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1t3ka_ | 132 | Dual specificity phosphatase Cdc25 {Thale cress (A | 99.5 | |
| d1rhsa2 | 144 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 99.46 | |
| d1qxna_ | 137 | Polysulfide-sulfur transferase (sulfide dehydrogen | 99.4 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 99.35 | |
| d1uara2 | 141 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 99.28 | |
| d1okga2 | 139 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 99.15 |
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Rhodanese/Cell cycle control phosphatase superfamily: Rhodanese/Cell cycle control phosphatase family: Cell cycle control phosphatase, catalytic domain domain: Erk2 binding domain of Mapk phosphatase mkp-3 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.88 E-value=2e-23 Score=148.76 Aligned_cols=122 Identities=28% Similarity=0.531 Sum_probs=101.2
Q ss_pred CCCccCHHHHHHHhccCCCCeEEEeecCcchhccCCCcCceecCCchhhHHhhhccccccccccCCHHHHHHHHhhCCCC
Q psy18174 13 LELCVSKSWLLQELRSDPSRLIILDCRSSNEYTESHIRHAVNFSIPSIMLRRLAAGKIELLSTIKCRELKEKIMNAYKDS 92 (144)
Q Consensus 13 ~~~~Is~~~L~~~l~~~~~~~~IlD~R~~~~y~~~HIpgAi~~~~~~~l~~r~~~~~~~~~~~lp~~~~~~~l~~~~~~~ 92 (144)
+...||++||+++|+..+++++|||||+..+|+.||||||+|++++.++.+|...+...+.+.+++.+.+..+.....++
T Consensus 14 ~~~~~s~e~L~~~l~~~~~~~lilDvR~~~ey~~~HI~gAini~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 93 (154)
T d1hzma_ 14 MAISKTVAWLNEQLELGNERLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPVRALFTRGEDRDRFTRRCGTD 93 (154)
T ss_dssp CSSBSCCCCHHHHHHHCSSSCEEECCSTTHHHHHHTSSSCCCCCCSSHHHHTBCCSCCCTTTTSTTSHHHHHHHHSTTSS
T ss_pred ccCccCHHHHHHHHhcCCCCEEEEECCCHHHHhcCCCCCCcccCcHHHHhhhccCCcccccccCCcHHHHHHHhhcCCCC
Confidence 45579999999999865678999999999999999999999999999888888777778888888887777776665688
Q ss_pred EEEEEcCCCCccccccccccccCCCccHHHHHHHHHHhcCceeEEeecc
Q psy18174 93 LFVVYGDSCMSEVEVRDREKHCYTASDTMNVLTKRLQQDGCQVVCLLVL 141 (144)
Q Consensus 93 ~VVvYD~~~~~~~~g~~~~~~~~~~~~~~~~~~~~L~~~g~~~~~l~G~ 141 (144)
+||+||+.+. .+. ........+..++++|...|+++++|+||
T Consensus 94 ~VVvYd~~~~------~~~-~~~~~~~~~~~l~~~l~~~~~~v~iL~GG 135 (154)
T d1hzma_ 94 TVVLYDESSS------DWN-ENTGGESLLGLLLKKLKDEGCRAFYLEGG 135 (154)
T ss_dssp CEEECCCSSS------SSC-SCSSCCSHHHHHHHHHHHTTCCCEECCCC
T ss_pred eEEEEcCCCc------hhh-hhHHHHHHHHHHHHHHHhcCCeEEEEeCc
Confidence 9999998722 121 12344568889999999999999999998
|
| >d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|