Diaphorina citri psyllid: psy18189


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MPELTELDKAVSSGGEAELHDDSGTESDSEDSIPELEASGDPLGSAGASGLANDLVSKAKQSRGEKKARKIMSKLGLKQIQGVSRVTIRKSKNILFVINKPDVFKNPPLSGSGFKDILN
ccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcHHHHHHHHHHHHcccccccccEEEEEECcccEEEEECccCEECcccccccCEEEccc
**************************************************************************LGLKQIQGVSRVTIRKSKNILFVINKPDVFKNPPLSGSGFKDILN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPELTELDKAVSSGGEAELHDDSGTESDSEDSIPELEASGDPLGSAGASGLANDLVSKAKQSRGEKKARKIMSKLGLKQIQGVSRVTIRKSKNILFVINKPDVFKNPPLSGSGFKDILN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nascent polypeptide-associated complex subunit alpha, muscle-specific form Prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. Also reduces the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites) (By similarity). Isoform 1 and isoform 2 appear to bind DNA and play roles in transcription. May act to regulate the expression of genes involved in the development of myotubes.confidentP70670
Nascent polypeptide-associated complex subunit alpha May promote appropriate targeting of ribosome-nascent polypeptide complexes.confidentQ68F90
Nascent polypeptide-associated complex subunit alpha-like protein 1 May promote appropriate targeting of ribosome-nascent polypeptide complexes.confidentQ9LHG9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003713 [MF]transcription coactivator activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0017025 [MF]TBP-class protein bindingprobableGO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0022626 [CC]cytosolic ribosomeprobableGO:0005737, GO:0032991, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0043228, GO:0005622, GO:0043226
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3MCE, chain A
Confidence level:very confident
Coverage over the Query: 69-117
View the alignment between query and template
View the model in PyMOL