Psyllid ID: psy18200


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---
ELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQASVYLIVCVLIRYQVDLRDGPDQVYLRELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQAS
cHHHHHHHHHHHHHHHHcccccccccccccEEEEcccccEEEEccccHHHcccccccccccccccccccHHHccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEccccccEEEEcccHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccc
cHHHHHHHHHHHHHHHHHccEEEEcccHHHEEEccccccEEEEccccccEEccccccEccccccHHHccHHHHHcccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccEEEEcccHHHEEEcccccccEEEccccccEEccccccEccccccHHHccHHHHHcccccccHHHHHHHHHHHHHHHcccccccc
ELLFLFSQLLLAVHFIHASKilhrdikpcnilltgskgnllklsdfgiskllnttnnarsivgtpsylspelclgkpysiqsdIWAMGCVLYFMTTHKIAFQASVYLIVCVLIRYQvdlrdgpdQVYLRELLFLFSQLLLAVHFIHASKilhrdikpcnilltgskgnllklsdfgiskllnttnnarsivgtpsylspelclgkpysiqsdIWAMGCVLYFMTTHKIAFQAS
ELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQASVYLIVCVLIRYQVDLRDGPDQVYLRELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQAS
EllflfsqlllAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQASVYLIVCVLIRYQVDLRDGPDQVYlrellflfsqlllAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQAS
*LLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQASVYLIVCVLIRYQVDLRDGPDQVYLRELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAF***
ELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQASVYLIVCVLIRYQVDLRDGPDQVYLRELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQ**
ELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQASVYLIVCVLIRYQVDLRDGPDQVYLRELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQAS
ELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQASVYLIVCVLIRYQVDLRDGPDQVYLRELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQ**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQASVYLIVCVLIRYQVDLRDGPDQVYLRELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query233 2.2.26 [Sep-21-2011]
Q86SG6 692 Serine/threonine-protein yes N/A 0.437 0.147 0.533 2e-25
Q91ZR4 698 Serine/threonine-protein yes N/A 0.437 0.146 0.533 2e-25
Q96PY6 1258 Serine/threonine-protein no N/A 0.545 0.100 0.464 6e-25
P51954 1203 Serine/threonine-protein no N/A 0.545 0.105 0.464 2e-24
Q90XC2 697 Serine/threonine-protein no N/A 0.437 0.146 0.524 8e-24
Q8K1R7 984 Serine/threonine-protein no N/A 0.459 0.108 0.513 5e-23
Q60DG4 943 Serine/threonine-protein yes N/A 0.433 0.107 0.466 3e-22
Q8TD19 979 Serine/threonine-protein no N/A 0.467 0.111 0.504 3e-22
Q94CU5 943 Serine/threonine-protein no N/A 0.523 0.129 0.412 5e-22
Q8RX66 568 Serine/threonine-protein yes N/A 0.403 0.165 0.520 5e-22
>sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 Back     alignment and function desciption
 Score =  116 bits (290), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 78/103 (75%), Gaps = 1/103 (0%)

Query: 2   LLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSI 61
           +L  F Q+LLA+H +H   ILHRD+K  NILL   +  ++K+ DFGISK+L++ + A ++
Sbjct: 105 ILHFFVQILLALHHVHTHLILHRDLKTQNILLDKHR-MVVKIGDFGISKILSSKSKAYTV 163

Query: 62  VGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQAS 104
           VGTP Y+SPELC GKPY+ +SDIWA+GCVLY + + K AF+A+
Sbjct: 164 VGTPCYISPELCEGKPYNQKSDIWALGCVLYELASLKRAFEAA 206




Required for renal tubular integrity. May regulate local cytoskeletal structure in kidney tubule epithelial cells. May regulate ciliary biogenesis through targeting of proteins to the cilia.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 Back     alignment and function description
>sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 Back     alignment and function description
>sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 Back     alignment and function description
>sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 Back     alignment and function description
>sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 Back     alignment and function description
>sp|Q60DG4|NEK4_ORYSJ Serine/threonine-protein kinase Nek4 OS=Oryza sativa subsp. japonica GN=NEK4 PE=2 SV=1 Back     alignment and function description
>sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 Back     alignment and function description
>sp|Q94CU5|NEK5_ORYSJ Serine/threonine-protein kinase Nek5 OS=Oryza sativa subsp. japonica GN=NEK5 PE=2 SV=1 Back     alignment and function description
>sp|Q8RX66|NEK3_ARATH Serine/threonine-protein kinase Nek3 OS=Arabidopsis thaliana GN=NEK3 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query233
357617795292 NIMA-related kinase 8 [Danaus plexippus] 0.476 0.380 0.522 3e-28
260792916 689 hypothetical protein BRAFLDRAFT_205444 [ 0.510 0.172 0.484 4e-26
156398544 676 predicted protein [Nematostella vectensi 0.442 0.152 0.538 9e-26
62955073 488 uncharacterized protein LOC548344 [Danio 0.429 0.204 0.582 1e-25
405964700 774 Serine/threonine-protein kinase Nek8 [Cr 0.446 0.134 0.523 1e-25
291221142 696 PREDICTED: NIMA-related kinase 8-like [S 0.420 0.140 0.565 1e-25
196010051 697 hypothetical protein TRIADDRAFT_28793 [T 0.442 0.147 0.538 2e-25
126314043 705 PREDICTED: serine/threonine-protein kina 0.437 0.144 0.533 3e-25
326935527 439 PREDICTED: serine/threonine-protein kina 0.510 0.271 0.476 3e-25
91090566179 PREDICTED: similar to NIMA (never in mit 0.575 0.748 0.384 4e-25
>gi|357617795|gb|EHJ70997.1| NIMA-related kinase 8 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 80/111 (72%)

Query: 123 PDQVYLRELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLN 182
           P  +  + +LF F Q+LL V++IH   I+HRD+K  NILLTG  G ++K+ DFGISK+L 
Sbjct: 105 PKLIKQQMILFYFCQVLLGVNYIHQLDIIHRDLKAENILLTGKNGLIVKIGDFGISKMLA 164

Query: 183 TTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQAS 233
           +     +++GTP YL+PELC GKPY  +SDIWA+GC+LY M THK AF++ 
Sbjct: 165 SAKKTSTVIGTPYYLAPELCEGKPYDTKSDIWALGCLLYEMCTHKRAFESE 215




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|260792916|ref|XP_002591460.1| hypothetical protein BRAFLDRAFT_205444 [Branchiostoma floridae] gi|229276665|gb|EEN47471.1| hypothetical protein BRAFLDRAFT_205444 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|156398544|ref|XP_001638248.1| predicted protein [Nematostella vectensis] gi|156225367|gb|EDO46185.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|62955073|ref|NP_001017548.1| uncharacterized protein LOC548344 [Danio rerio] gi|62089543|gb|AAH92172.1| Zgc:113355 [Danio rerio] gi|182890030|gb|AAI65186.1| Zgc:113355 protein [Danio rerio] Back     alignment and taxonomy information
>gi|405964700|gb|EKC30153.1| Serine/threonine-protein kinase Nek8 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|291221142|ref|XP_002730582.1| PREDICTED: NIMA-related kinase 8-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|196010051|ref|XP_002114890.1| hypothetical protein TRIADDRAFT_28793 [Trichoplax adhaerens] gi|190582273|gb|EDV22346.1| hypothetical protein TRIADDRAFT_28793 [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|126314043|ref|XP_001376037.1| PREDICTED: serine/threonine-protein kinase Nek8 [Monodelphis domestica] Back     alignment and taxonomy information
>gi|326935527|ref|XP_003213821.1| PREDICTED: serine/threonine-protein kinase Nek8-like, partial [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|91090566|ref|XP_971713.1| PREDICTED: similar to NIMA (never in mitosis gene a)-related expressed kinase 8 [Tribolium castaneum] gi|270013346|gb|EFA09794.1| hypothetical protein TcasGA2_TC011936 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query233
UNIPROTKB|F1LWV7568 F1LWV7 "Uncharacterized protei 0.377 0.154 0.451 6.4e-28
ZFIN|ZDB-GENE-050410-11 488 zgc:113355 "zgc:113355" [Danio 0.386 0.184 0.623 1.1e-24
ZFIN|ZDB-GENE-070209-74 739 rps6ka3b "ribosomal protein S6 0.381 0.120 0.380 1.2e-23
UNIPROTKB|F1NLJ3 697 RPS6KA3 "Uncharacterized prote 0.360 0.120 0.356 4.3e-23
UNIPROTKB|F5GYC4 710 RPS6KA3 "Ribosomal protein S6 0.360 0.118 0.356 4.5e-23
UNIPROTKB|B4DG22 711 RPS6KA3 "cDNA FLJ56618, highly 0.360 0.118 0.356 4.5e-23
UNIPROTKB|F1SQN4 711 RPS6KA3 "Uncharacterized prote 0.360 0.118 0.356 4.5e-23
UNIPROTKB|E2RP04 712 RPS6KA3 "Uncharacterized prote 0.360 0.117 0.356 4.5e-23
UNIPROTKB|B7ZB17 712 RPS6KA3 "cDNA, FLJ79381, highl 0.360 0.117 0.356 4.5e-23
UNIPROTKB|K7GQW4 712 RPS6KA3 "Uncharacterized prote 0.360 0.117 0.356 4.5e-23
UNIPROTKB|F1LWV7 F1LWV7 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 173 (66.0 bits), Expect = 6.4e-28, Sum P(2) = 6.4e-28
 Identities = 42/93 (45%), Positives = 60/93 (64%)

Query:   141 AVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGIS-KLLNTTNNARSIVGTPSYLSP 199
             A+ + H+  I+HRDIKP NIL+ G +GN+ KL DFG + K    T  +R   GT  + +P
Sbjct:   424 AIRYCHSLDIVHRDIKPQNILIDG-EGNI-KLIDFGQAIKCKPGTLLSRHC-GTRDFNAP 480

Query:   200 ELCLGKPYSIQS-DIWAMGCVLYFMTTHKIAFQ 231
             EL L +PY  +S D+W++G VLYF TT  + F+
Sbjct:   481 ELVLREPYDGKSSDVWSLGVVLYFFTTGYLPFR 513


GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
ZFIN|ZDB-GENE-050410-11 zgc:113355 "zgc:113355" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070209-74 rps6ka3b "ribosomal protein S6 kinase, polypeptide 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLJ3 RPS6KA3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F5GYC4 RPS6KA3 "Ribosomal protein S6 kinase alpha-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DG22 RPS6KA3 "cDNA FLJ56618, highly similar to Ribosomal protein S6 kinase alpha-3 (EC 2.7.11.1)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQN4 RPS6KA3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RP04 RPS6KA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B7ZB17 RPS6KA3 "cDNA, FLJ79381, highly similar to Ribosomal protein S6 kinase alpha-3 (EC 2.7.11.1)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7GQW4 RPS6KA3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8RX66NEK3_ARATH2, ., 7, ., 1, 1, ., 10.52080.40340.1654yesN/A
Q91ZR4NEK8_MOUSE2, ., 7, ., 1, 1, ., 10.53390.43770.1461yesN/A
Q86SG6NEK8_HUMAN2, ., 7, ., 1, 1, ., 10.53390.43770.1473yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.1LOW CONFIDENCE prediction!
3rd Layer2.7.110.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query233
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 4e-48
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 1e-47
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 4e-37
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 6e-37
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 6e-37
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 2e-36
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 2e-36
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 1e-35
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 5e-35
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 1e-34
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 3e-33
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 3e-33
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 9e-31
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 1e-30
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 3e-30
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 6e-30
pfam00069260 pfam00069, Pkinase, Protein kinase domain 9e-30
pfam00069260 pfam00069, Pkinase, Protein kinase domain 1e-29
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 8e-29
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 8e-29
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 1e-27
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 1e-27
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 1e-27
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 1e-27
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 7e-27
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 7e-27
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 2e-26
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 2e-26
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 2e-26
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-26
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-26
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 3e-26
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 5e-26
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 2e-25
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 2e-25
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 4e-25
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 4e-25
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 8e-25
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 3e-23
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 5e-23
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 8e-23
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 2e-22
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 2e-22
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 3e-22
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 3e-22
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 3e-22
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 5e-22
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 5e-22
PTZ00283 496 PTZ00283, PTZ00283, serine/threonine protein kinas 8e-22
PTZ00283 496 PTZ00283, PTZ00283, serine/threonine protein kinas 8e-22
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 1e-21
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 1e-21
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 2e-21
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 2e-21
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 4e-21
cd05573 350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 4e-21
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 7e-21
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 7e-21
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 1e-20
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-20
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 2e-20
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 2e-20
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-20
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-20
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 2e-20
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 2e-20
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 4e-20
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 4e-20
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 4e-20
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 5e-20
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-19
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-19
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 2e-19
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 2e-19
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 2e-19
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 2e-19
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 3e-19
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 3e-19
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 7e-19
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 7e-19
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 8e-19
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 9e-19
cd05600 333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 9e-19
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 9e-19
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 9e-19
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 1e-18
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 1e-18
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 1e-18
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 1e-18
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 1e-18
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 1e-18
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 2e-18
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 3e-18
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 3e-18
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 3e-18
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 3e-18
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 3e-18
cd06615 308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 3e-18
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 4e-18
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 4e-18
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 4e-18
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 4e-18
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 1e-17
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 1e-17
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 1e-17
PTZ00267 478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 1e-17
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 1e-17
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 1e-17
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 1e-17
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 2e-17
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 2e-17
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 2e-17
cd07852 337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 2e-17
cd07834 330 cd07834, STKc_MAPK, Catalytic domain of the Serine 5e-17
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 7e-17
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 7e-17
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 8e-17
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 8e-17
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 8e-17
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 8e-17
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 8e-17
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 1e-16
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 1e-16
cd06650333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 1e-16
cd06650 333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 1e-16
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 2e-16
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 2e-16
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 3e-16
cd05599 364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 3e-16
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 3e-16
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 3e-16
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 5e-16
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 6e-16
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 6e-16
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 8e-16
cd05585 312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 8e-16
cd07874355 cd07874, STKc_JNK3, Catalytic domain of the Serine 8e-16
cd07853372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 9e-16
cd07853 372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 9e-16
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 1e-15
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 1e-15
cd06649331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 1e-15
cd06649 331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 1e-15
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 1e-15
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 1e-15
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 1e-15
cd07874 355 cd07874, STKc_JNK3, Catalytic domain of the Serine 2e-15
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 2e-15
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 2e-15
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 2e-15
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 2e-15
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 2e-15
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 2e-15
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 3e-15
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 3e-15
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 3e-15
cd07875364 cd07875, STKc_JNK1, Catalytic domain of the Serine 3e-15
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 3e-15
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 3e-15
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 3e-15
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 3e-15
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 3e-15
PTZ00263 329 PTZ00263, PTZ00263, protein kinase A catalytic sub 3e-15
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 4e-15
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 4e-15
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 4e-15
cd07850 353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 5e-15
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 5e-15
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 5e-15
cd05601 330 cd05601, STKc_CRIK, Catalytic domain of the Protei 5e-15
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 6e-15
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 6e-15
cd07875 364 cd07875, STKc_JNK1, Catalytic domain of the Serine 7e-15
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 7e-15
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 7e-15
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 8e-15
cd05570 318 cd05570, STKc_PKC, Catalytic domain of the Protein 8e-15
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 9e-15
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 1e-14
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 1e-14
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 1e-14
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 1e-14
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 1e-14
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 1e-14
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 2e-14
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 2e-14
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 2e-14
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 2e-14
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 2e-14
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 2e-14
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 2e-14
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 3e-14
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 3e-14
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 3e-14
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 3e-14
cd07868317 cd07868, STKc_CDK8, Catalytic domain of the Serine 4e-14
cd07868317 cd07868, STKc_CDK8, Catalytic domain of the Serine 4e-14
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 4e-14
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 4e-14
cd07867317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 4e-14
cd07867317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 4e-14
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 4e-14
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 4e-14
cd05575323 cd05575, STKc_SGK, Catalytic domain of the Protein 7e-14
cd05575 323 cd05575, STKc_SGK, Catalytic domain of the Protein 7e-14
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 7e-14
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 7e-14
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 7e-14
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 7e-14
cd05596 370 cd05596, STKc_ROCK, Catalytic domain of the Protei 7e-14
cd07876359 cd07876, STKc_JNK2, Catalytic domain of the Serine 7e-14
cd07876 359 cd07876, STKc_JNK2, Catalytic domain of the Serine 7e-14
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 7e-14
cd05592 316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 7e-14
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 7e-14
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 7e-14
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 7e-14
cd05604325 cd05604, STKc_SGK3, Catalytic domain of the Protei 8e-14
cd05604 325 cd05604, STKc_SGK3, Catalytic domain of the Protei 8e-14
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 9e-14
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 9e-14
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 9e-14
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 9e-14
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 9e-14
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 9e-14
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 1e-13
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 1e-13
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 1e-13
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 1e-13
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 1e-13
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 1e-13
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 1e-13
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 1e-13
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 2e-13
cd05624 331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 2e-13
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 2e-13
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 2e-13
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 2e-13
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 2e-13
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 2e-13
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 2e-13
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-13
cd05582 318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 2e-13
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 2e-13
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 3e-13
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 3e-13
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 3e-13
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 3e-13
cd05597 331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 3e-13
cd05588329 cd05588, STKc_aPKC, Catalytic domain of the Protei 3e-13
cd05588 329 cd05588, STKc_aPKC, Catalytic domain of the Protei 3e-13
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 4e-13
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 5e-13
cd05622 371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 5e-13
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 5e-13
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 5e-13
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 5e-13
cd05595 323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 5e-13
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 6e-13
cd05619 316 cd05619, STKc_nPKC_theta, Catalytic domain of the 6e-13
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 6e-13
cd07872 309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 6e-13
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 7e-13
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 9e-13
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 9e-13
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 9e-13
cd05603321 cd05603, STKc_SGK2, Catalytic domain of the Protei 9e-13
cd05603 321 cd05603, STKc_SGK2, Catalytic domain of the Protei 9e-13
cd07855 334 cd07855, STKc_ERK5, Catalytic domain of the Serine 1e-12
cd07851 343 cd07851, STKc_p38, Catalytic domain of the Serine/ 1e-12
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 1e-12
cd05602325 cd05602, STKc_SGK1, Catalytic domain of the Protei 1e-12
cd05602 325 cd05602, STKc_SGK1, Catalytic domain of the Protei 1e-12
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 1e-12
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 1e-12
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 1e-12
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 1e-12
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 1e-12
cd05620 316 cd05620, STKc_nPKC_delta, Catalytic domain of the 1e-12
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 1e-12
cd05591 321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 1e-12
cd05618329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 1e-12
cd05618 329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 1e-12
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 2e-12
cd05621 370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 2e-12
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 2e-12
cd07854 342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 2e-12
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 2e-12
cd05586 330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 2e-12
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 2e-12
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 2e-12
cd07859338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 2e-12
cd07859 338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 2e-12
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 2e-12
cd05593 328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 2e-12
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 2e-12
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 2e-12
PHA03210 501 PHA03210, PHA03210, serine/threonine kinase US3; P 2e-12
cd05617327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 3e-12
cd05617 327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 3e-12
PHA03207 392 PHA03207, PHA03207, serine/threonine kinase US3; P 4e-12
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 4e-12
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 4e-12
cd05629 377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 5e-12
cd07880343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 5e-12
cd07858 337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 6e-12
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 6e-12
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 6e-12
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 6e-12
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 6e-12
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 6e-12
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 6e-12
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 6e-12
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 6e-12
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 6e-12
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 7e-12
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 7e-12
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 7e-12
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 7e-12
cd05627 360 cd05627, STKc_NDR2, Catalytic domain of the Protei 7e-12
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 8e-12
PTZ00426 340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 9e-12
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 9e-12
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 1e-11
cd07880 343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 1e-11
cd07849 336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 1e-11
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 1e-11
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 1e-11
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 1e-11
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 1e-11
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 1e-11
cd05587 324 cd05587, STKc_cPKC, Catalytic domain of the Protei 1e-11
PTZ00036440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 1e-11
PTZ00036 440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 1e-11
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 1e-11
cd05615 323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 1e-11
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 1e-11
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 1e-11
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 1e-11
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 2e-11
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 2e-11
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 2e-11
cd05616 323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 2e-11
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 2e-11
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 2e-11
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 2e-11
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 2e-11
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 2e-11
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 2e-11
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 2e-11
cd07877 345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 2e-11
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 3e-11
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 3e-11
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 3e-11
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 3e-11
cd05589 324 cd05589, STKc_PKN, Catalytic domain of the Protein 3e-11
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 3e-11
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 3e-11
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 3e-11
cd05598 376 cd05598, STKc_LATS, Catalytic domain of the Protei 3e-11
PHA03210501 PHA03210, PHA03210, serine/threonine kinase US3; P 4e-11
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 4e-11
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 4e-11
cd07878343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 4e-11
cd07879342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 5e-11
cd05571 323 cd05571, STKc_PKB, Catalytic domain of the Protein 5e-11
cd07857 332 cd07857, STKc_MPK1, Catalytic domain of the Serine 6e-11
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 6e-11
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 6e-11
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 7e-11
cd05590 320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 7e-11
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 7e-11
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 8e-11
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 8e-11
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 8e-11
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 9e-11
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 1e-10
cd05594 325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 1e-10
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 1e-10
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 1e-10
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 2e-10
cd07878 343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 2e-10
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 2e-10
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 2e-10
cd05628 363 cd05628, STKc_NDR1, Catalytic domain of the Protei 2e-10
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 3e-10
cd07879 342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 3e-10
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 3e-10
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 3e-10
cd05623 332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 3e-10
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 3e-10
cd07856 328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 3e-10
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 5e-10
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 5e-10
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 6e-10
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 6e-10
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 6e-10
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 6e-10
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 6e-10
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 7e-10
cd05626381 cd05626, STKc_LATS2, Catalytic domain of the Prote 7e-10
cd05626 381 cd05626, STKc_LATS2, Catalytic domain of the Prote 7e-10
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 7e-10
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 1e-09
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 1e-09
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 1e-09
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 1e-09
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 1e-09
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 1e-09
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 1e-09
cd05584 323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 1e-09
cd05625 382 cd05625, STKc_LATS1, Catalytic domain of the Prote 2e-09
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 2e-09
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 2e-09
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 2e-09
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 2e-09
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 3e-09
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 4e-09
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 4e-09
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 5e-09
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 5e-09
PHA03212 391 PHA03212, PHA03212, serine/threonine kinase US3; P 5e-09
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 8e-09
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 8e-09
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 8e-09
cd05614 332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 8e-09
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 9e-09
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 9e-09
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 1e-08
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 1e-08
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 1e-08
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 1e-08
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 1e-08
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 1e-08
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 2e-08
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 2e-08
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 2e-08
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 3e-08
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 3e-08
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 4e-08
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 5e-08
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 5e-08
PTZ00284 467 PTZ00284, PTZ00284, protein kinase; Provisional 5e-08
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 6e-08
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 7e-08
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 8e-08
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 8e-08
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 8e-08
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 1e-07
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 1e-07
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 1e-07
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 1e-07
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 1e-07
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 2e-07
PTZ00284467 PTZ00284, PTZ00284, protein kinase; Provisional 2e-07
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 2e-07
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 2e-07
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 2e-07
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 2e-07
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 2e-07
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 3e-07
cd05108 316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 3e-07
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 3e-07
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 4e-07
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 4e-07
cd05104375 cd05104, PTKc_Kit, Catalytic domain of the Protein 4e-07
cd05104375 cd05104, PTKc_Kit, Catalytic domain of the Protein 4e-07
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 4e-07
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 4e-07
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 4e-07
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 5e-07
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 5e-07
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 5e-07
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 6e-07
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 7e-07
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 7e-07
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 8e-07
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 1e-06
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 1e-06
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 1e-06
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 1e-06
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 1e-06
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 2e-06
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 2e-06
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 2e-06
cd05610669 cd05610, STKc_MASTL, Catalytic domain of the Prote 3e-06
cd05610669 cd05610, STKc_MASTL, Catalytic domain of the Prote 3e-06
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 3e-06
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 3e-06
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 3e-06
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 3e-06
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 3e-06
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 3e-06
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 3e-06
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 4e-06
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 4e-06
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 5e-06
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 5e-06
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 6e-06
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 6e-06
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 7e-06
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 7e-06
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 1e-05
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 1e-05
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 1e-05
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 1e-05
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 2e-05
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 2e-05
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 2e-05
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 2e-05
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 2e-05
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 2e-05
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 2e-05
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 2e-05
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 2e-05
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 3e-05
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 3e-05
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 3e-05
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 5e-05
cd05107401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 5e-05
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 6e-05
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 9e-05
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 1e-04
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 1e-04
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 1e-04
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 1e-04
PLN03225566 PLN03225, PLN03225, Serine/threonine-protein kinas 1e-04
PLN03225 566 PLN03225, PLN03225, Serine/threonine-protein kinas 1e-04
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 1e-04
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 1e-04
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 1e-04
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 2e-04
cd05107401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 2e-04
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 2e-04
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 2e-04
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 2e-04
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 2e-04
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 2e-04
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 3e-04
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 3e-04
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 3e-04
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 4e-04
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 4e-04
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 5e-04
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 6e-04
cd08226 328 cd08226, PK_STRAD_beta, Pseudokinase domain of STE 7e-04
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 8e-04
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 8e-04
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 8e-04
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 8e-04
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 9e-04
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 0.001
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 0.001
cd08226328 cd08226, PK_STRAD_beta, Pseudokinase domain of STE 0.001
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 0.001
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 0.001
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 0.001
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 0.001
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 0.001
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 0.001
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 0.001
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 0.001
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 0.002
PLN03224507 PLN03224, PLN03224, probable serine/threonine prot 0.002
PLN03224507 PLN03224, PLN03224, probable serine/threonine prot 0.002
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 0.003
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 0.004
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 0.004
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 0.004
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 0.004
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 0.004
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 0.004
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
 Score =  158 bits (403), Expect = 4e-48
 Identities = 69/140 (49%), Positives = 91/140 (65%), Gaps = 5/140 (3%)

Query: 1   ELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNN-AR 59
           ++L  F QL LA+ ++H+ KILHRDIKP NI LT     L+KL DFGISK+L++T + A+
Sbjct: 104 QILDWFVQLCLALKYLHSRKILHRDIKPQNIFLT--SNGLVKLGDFGISKVLSSTVDLAK 161

Query: 60  SIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQASVYLIVCVLIRYQVDL 119
           ++VGTP YLSPELC  KPY+ +SDIW++GCVLY + T K  F+    L + + I      
Sbjct: 162 TVVGTPYYLSPELCQNKPYNYKSDIWSLGCVLYELCTLKHPFEGENLLELALKILKG-QY 220

Query: 120 RDGPDQVYLRELLFLFSQLL 139
              P Q Y  EL  L S LL
Sbjct: 221 PPIPSQ-YSSELRNLVSSLL 239


Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Length = 258

>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|140307 PTZ00284, PTZ00284, protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|140307 PTZ00284, PTZ00284, protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173766 cd08226, PK_STRAD_beta, Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|173766 cd08226, PK_STRAD_beta, Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 233
KOG0603|consensus612 100.0
KOG0616|consensus355 100.0
KOG0598|consensus357 100.0
KOG0591|consensus375 100.0
KOG0615|consensus475 100.0
KOG0592|consensus 604 100.0
KOG0575|consensus 592 100.0
KOG0033|consensus355 100.0
KOG0694|consensus694 100.0
KOG0581|consensus364 100.0
KOG0595|consensus429 100.0
KOG0583|consensus370 100.0
KOG0588|consensus 786 100.0
KOG0605|consensus550 99.98
KOG0578|consensus550 99.97
KOG0599|consensus411 99.97
KOG0614|consensus732 99.97
KOG0986|consensus591 99.97
KOG0597|consensus 808 99.97
KOG0589|consensus426 99.97
KOG0598|consensus 357 99.97
KOG0593|consensus396 99.97
KOG0198|consensus313 99.97
KOG0585|consensus 576 99.97
KOG0696|consensus683 99.96
KOG0594|consensus323 99.96
KOG0690|consensus516 99.96
KOG4717|consensus 864 99.96
KOG0580|consensus281 99.96
KOG0600|consensus 560 99.96
KOG0660|consensus359 99.96
KOG0604|consensus400 99.96
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.96
KOG0659|consensus318 99.96
KOG0032|consensus382 99.96
KOG0658|consensus364 99.96
KOG0201|consensus 467 99.96
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.96
KOG0611|consensus 668 99.95
KOG0192|consensus362 99.95
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.95
KOG0661|consensus 538 99.95
KOG0610|consensus459 99.95
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.95
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.95
KOG0603|consensus612 99.95
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.95
KOG0591|consensus 375 99.95
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.95
KOG0616|consensus 355 99.95
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.95
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.95
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.95
KOG0694|consensus 694 99.95
PTZ00036440 glycogen synthase kinase; Provisional 99.95
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.95
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.95
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.95
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.95
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.95
KOG0595|consensus 429 99.95
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.95
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.95
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.95
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.95
KOG0663|consensus419 99.95
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.95
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.95
PTZ00283 496 serine/threonine protein kinase; Provisional 99.95
PTZ00267478 NIMA-related protein kinase; Provisional 99.95
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.95
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.95
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.95
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.95
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.95
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.95
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.95
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.95
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.94
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.94
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.94
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.94
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.94
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.94
KOG0983|consensus391 99.94
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.94
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.94
KOG0667|consensus586 99.94
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.94
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.94
KOG4721|consensus 904 99.94
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.94
PTZ00284467 protein kinase; Provisional 99.94
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.94
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.94
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.94
KOG0596|consensus677 99.94
KOG0582|consensus 516 99.94
KOG0695|consensus593 99.94
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.94
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.94
KOG0579|consensus 1187 99.94
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.94
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.94
KOG0612|consensus 1317 99.94
KOG0592|consensus 604 99.94
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.94
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.94
KOG0575|consensus 592 99.94
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.94
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.94
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.94
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.94
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.93
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.93
KOG0600|consensus 560 99.93
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.93
KOG4279|consensus 1226 99.93
KOG0665|consensus369 99.93
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.93
KOG0615|consensus475 99.93
PHA03212391 serine/threonine kinase US3; Provisional 99.93
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.93
KOG0588|consensus 786 99.93
KOG0608|consensus1034 99.93
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.93
PHA02882294 putative serine/threonine kinase; Provisional 99.93
KOG0605|consensus 550 99.93
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.93
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.93
KOG4236|consensus888 99.93
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.93
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.93
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.93
KOG0594|consensus323 99.93
KOG0593|consensus 396 99.93
KOG0577|consensus 948 99.93
KOG0581|consensus364 99.93
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.93
KOG0696|consensus 683 99.93
KOG0583|consensus 370 99.93
KOG0667|consensus 586 99.93
KOG0597|consensus 808 99.93
KOG0984|consensus282 99.93
PHA03207392 serine/threonine kinase US3; Provisional 99.93
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.93
KOG0197|consensus468 99.93
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.93
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.92
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.92
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.92
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.92
PHA03209357 serine/threonine kinase US3; Provisional 99.92
KOG4645|consensus1509 99.92
PHA02988283 hypothetical protein; Provisional 99.92
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.92
KOG0586|consensus 596 99.92
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.92
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.92
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.92
PHA03211461 serine/threonine kinase US3; Provisional 99.92
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.92
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.92
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.92
PLN00181 793 protein SPA1-RELATED; Provisional 99.92
PHA03210501 serine/threonine kinase US3; Provisional 99.92
KOG0661|consensus 538 99.92
KOG0033|consensus 355 99.92
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.92
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.92
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.92
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.92
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.92
KOG4250|consensus 732 99.92
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.92
KOG0578|consensus550 99.92
KOG0599|consensus 411 99.92
KOG0986|consensus 591 99.92
KOG0607|consensus463 99.92
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.91
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.91
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.91
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.91
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.91
KOG0193|consensus678 99.91
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.91
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.91
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.91
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.91
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.91
KOG0663|consensus 419 99.91
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.91
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.91
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.91
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.91
KOG0658|consensus 364 99.91
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.91
KOG0664|consensus449 99.91
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.91
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.91
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.91
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.91
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.91
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.91
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.91
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.91
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.91
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.91
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.91
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.91
KOG0668|consensus338 99.91
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.91
KOG0584|consensus 632 99.91
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.91
KOG0590|consensus601 99.91
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.91
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.91
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.91
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.91
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.91
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.91
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.91
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.91
KOG0666|consensus438 99.91
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.91
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.9
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.9
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.9
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.9
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.9
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.9
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.9
KOG0660|consensus 359 99.9
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.9
KOG0589|consensus 426 99.9
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.9
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.9
KOG1035|consensus 1351 99.9
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.9
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.9
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.9
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.9
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.9
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.9
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.9
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.9
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.9
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.9
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.9
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.9
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.9
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.9
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.9
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.9
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.9
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.9
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.9
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.9
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.9
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.9
KOG0192|consensus 362 99.9
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.9
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.9
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.9
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.9
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.9
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.9
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.9
KOG1006|consensus361 99.9
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.9
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.9
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.9
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.9
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.9
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.9
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.9
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.9
KOG0574|consensus 502 99.9
KOG0614|consensus 732 99.9
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.9
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.9
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.9
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.89
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.89
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.89
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.89
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.89
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.89
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.89
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.89
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.89
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.89
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.89
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.89
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.89
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.89
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.89
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.89
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.89
KOG0669|consensus376 99.89
KOG4721|consensus 904 99.89
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.89
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.89
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.89
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.89
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.89
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.89
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.89
KOG0596|consensus 677 99.89
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.89
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.89
KOG0198|consensus313 99.89
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.89
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.89
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.89
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.89
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.89
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.89
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.89
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.89
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.89
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.89
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.89
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.89
KOG0659|consensus 318 99.89
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.89
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.89
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.89
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.89
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.89
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.89
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.89
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.89
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.89
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.89
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.89
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.89
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.89
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.89
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.89
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.89
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.89
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.89
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.89
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.88
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.88
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.88
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.88
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.88
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.88
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.88
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.88
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.88
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.88
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.88
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.88
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.88
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.88
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.88
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.88
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.88
KOG0604|consensus 400 99.88
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.88
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.88
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.88
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.88
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.88
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.88
KOG0695|consensus 593 99.88
PLN00009294 cyclin-dependent kinase A; Provisional 99.88
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.88
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.88
PHA02882294 putative serine/threonine kinase; Provisional 99.88
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.88
KOG1989|consensus 738 99.88
KOG4717|consensus 864 99.88
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.88
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.88
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.88
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.88
PTZ00036 440 glycogen synthase kinase; Provisional 99.88
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.88
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.88
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.88
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.88
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.88
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.88
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.88
KOG0611|consensus 668 99.87
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.87
KOG0585|consensus 576 99.87
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.87
KOG1027|consensus903 99.87
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.87
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.87
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.87
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.87
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.87
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.87
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.87
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.87
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.87
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.87
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.87
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.87
KOG0662|consensus292 99.87
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.87
KOG0690|consensus 516 99.87
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.87
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.87
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.87
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.87
KOG0580|consensus281 99.87
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.87
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.87
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.87
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.87
KOG0032|consensus 382 99.87
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.87
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.87
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.87
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.87
KOG0201|consensus 467 99.87
KOG2345|consensus302 99.87
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.87
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.87
PTZ00284 467 protein kinase; Provisional 99.87
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.87
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.87
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.87
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.87
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.86
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.86
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.86
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.86
KOG0587|consensus 953 99.86
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.86
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.86
KOG0671|consensus415 99.86
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.86
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.86
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.86
KOG0983|consensus391 99.86
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.86
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.86
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.86
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.86
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.86
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.86
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.86
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.86
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.86
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.86
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.86
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.86
PHA03212 391 serine/threonine kinase US3; Provisional 99.86
KOG4236|consensus 888 99.86
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.86
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.86
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.86
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.86
PLN03224507 probable serine/threonine protein kinase; Provisio 99.86
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.86
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.86
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.86
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.86
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.86
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.86
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.86
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.86
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.86
PTZ00283 496 serine/threonine protein kinase; Provisional 99.86
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.85
KOG1095|consensus1025 99.85
KOG0612|consensus 1317 99.85
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.85
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.85
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.85
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.85
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.85
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.85
KOG4250|consensus 732 99.85
PTZ00267 478 NIMA-related protein kinase; Provisional 99.85
KOG0582|consensus 516 99.85
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.85
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.85
PHA03207 392 serine/threonine kinase US3; Provisional 99.85
KOG0610|consensus 459 99.85
KOG1187|consensus361 99.85
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.85
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.85
KOG0665|consensus 369 99.85
KOG0664|consensus 449 99.85
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.84
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.84
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.84
KOG4279|consensus 1226 99.84
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.84
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.84
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.84
>KOG0603|consensus Back     alignment and domain information
Probab=100.00  E-value=4e-39  Score=272.01  Aligned_cols=221  Identities=29%  Similarity=0.450  Sum_probs=172.6

Q ss_pred             HHHHHHHHHHHHHHHHhCCCeecCCCCCCeEEecCCCCcEEEEeeeceeeecCCCCccccccCCccccccccCCCCCCcc
Q psy18200          2 LLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQ   81 (233)
Q Consensus         2 ~~~~~~qi~~~l~~lH~~~iihrdik~~nil~~~~~~~~~kl~dfg~~~~~~~~~~~~~~~gt~~y~ape~~~~~~~~~~   81 (233)
                      +.+|.++++.|++++|+.+|+|||+|++||+++.+  |.+++.|||+++..-.....   |||..|||||+++  .+...
T Consensus        99 ~~~~~aelaLald~lh~l~iiyrd~k~enilld~~--Ghi~~tdfglske~v~~~~~---cgt~eymApEI~~--gh~~a  171 (612)
T KOG0603|consen   99 VAFYLAELALALDHLHKLGIAYRDYKLENVLLLLE--GHIKLTDFGLSKEAVKEKIA---CGTYEYRAPEIIN--GHLSA  171 (612)
T ss_pred             HHHHHHHHHHHHhhcchhHHHHhcccccceeeccc--CccccCCchhhhHhHhhhhc---ccchhhhhhHhhh--ccCCc
Confidence            56789999999999999999999999999999655  88999999999865443222   8999999999998  45778


Q ss_pred             chHHHHHHHHHHHhhccccchhhHHHHHHH-------------------------------------HHHhh--------
Q psy18200         82 SDIWAMGCVLYFMTTHKIAFQASVYLIVCV-------------------------------------LIRYQ--------  116 (233)
Q Consensus        82 ~diwslg~~~~~~~~~~~pf~~~~~~~l~~-------------------------------------~i~~~--------  116 (233)
                      +|+||+|++.+||++|..||.......+..                                     .+.+.        
T Consensus       172 ~D~ws~gvl~felltg~~pf~~~~~~~Il~~~~~~p~~l~~~a~~~~~~l~~r~p~nrLg~~~~~~~eik~h~f~~~i~~  251 (612)
T KOG0603|consen  172 ADWWSFGVLAFELLTGTLPFGGDTMKRILKAELEMPRELSAEARSLFRQLFKRNPENRLGAGPDGVDEIKQHEFFQSIDW  251 (612)
T ss_pred             ccchhhhhhHHHHhhCCCCCchHHHHHHhhhccCCchhhhHHHHHHHHHHHhhCHHHHhccCcchhHHHhccchheeeeH
Confidence            899999999999999999997722111000                                     00000        


Q ss_pred             ------c------------------c--C----C---------------------------------CCCCc--------
Q psy18200        117 ------V------------------D--L----R---------------------------------DGPDQ--------  125 (233)
Q Consensus       117 ------~------------------~--~----~---------------------------------~~~~~--------  125 (233)
                            .                  +  +    |                                 ++.++        
T Consensus       252 ~~l~~r~~~~~fkp~~~~e~~~~~fd~eft~~~P~dsp~~~~~~s~~~if~g~sfva~~il~~~~~~~~~~~y~~~~~~~  331 (612)
T KOG0603|consen  252 NELEARSRPPPFKPGSITERDVAQFDPEFTSQVPADSPLLSASGSDHTIFSGPSFVAPGVLEDAVTAPFTESYEFREELG  331 (612)
T ss_pred             hhHhhcCCCCCCCCcccchhhhhhcCchhccCCcccCCCCCCCccccchhcCCCccChHHhhccccCCcchhhccccccC
Confidence                  0                  0  0    0                                 00000        


Q ss_pred             --------------------------------------------------------------------------------
Q psy18200        126 --------------------------------------------------------------------------------  125 (233)
Q Consensus       126 --------------------------------------------------------------------------------  125 (233)
                                                                                                      
T Consensus       332 ~gs~s~~~~~~~~~t~~~~~vkii~~~~~~~~~e~~~~~~~~~h~niv~~~~v~~~~~~~~~v~e~l~g~ell~ri~~~~  411 (612)
T KOG0603|consen  332 EGSFSAVKYCESSPTDQEPAVKIISKRADDNQDEIPISLLVRDHPNIVKSHDVYEDGKEIYLVMELLDGGELLRRIRSKP  411 (612)
T ss_pred             CCCccceeeeeccccccchhheeccccccccccccchhhhhcCCCcceeecceecCCceeeeeehhccccHHHHHHHhcc
Confidence                                                                                            


Q ss_pred             hhHHHHHHHHHHHHHHhhhcccCCccccCCCCCceEEecCCCCcEEEEeecCccccCCCCCccccccCCcccccceeCCC
Q psy18200        126 VYLRELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGK  205 (233)
Q Consensus       126 ~~~~~~~~~~~q~l~~~~~~~~~~i~h~dlk~~nil~~~~~~~~~~~~dfg~~~~~~~~~~~~~~~g~~~~~ape~~~~~  205 (233)
                      ....++..++.+++.++.++|++|++||||||+|||++ +..+.++++|||.++..+..  ..+.+-|..|.|||++...
T Consensus       412 ~~~~e~~~w~~~lv~Av~~LH~~gvvhRDLkp~NIL~~-~~~g~lrltyFG~a~~~~~~--~~tp~~t~~y~APEvl~~~  488 (612)
T KOG0603|consen  412 EFCSEASQWAAELVSAVDYLHEQGVVHRDLKPGNILLD-GSAGHLRLTYFGFWSELERS--CDTPALTLQYVAPEVLAIQ  488 (612)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHhcCeeecCCChhheeec-CCCCcEEEEEechhhhCchh--hcccchhhcccChhhhccC
Confidence            00234556899999999999999999999999999996 33477999999998765433  3344567889999999999


Q ss_pred             CCCcchhHHHHHHHHHHHHhCCCCCCC
Q psy18200        206 PYSIQSDIWAMGCVLYFMTTHKIAFQA  232 (233)
Q Consensus       206 ~~~~~~DiwslG~i~~el~~~~~pf~~  232 (233)
                      .|+.++||||||++||+|++|+.||++
T Consensus       489 ~yt~acD~WSLGvlLy~ML~G~tp~~~  515 (612)
T KOG0603|consen  489 EYTEACDWWSLGVLLYEMLTGRTLFAA  515 (612)
T ss_pred             CCCcchhhHHHHHHHHHHHhCCCcccc
Confidence            999999999999999999999999974



>KOG0616|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query233
4apc_A350 Crystal Structure Of Human Nima-Related Kinase 1 (N 5e-23
4apc_A 350 Crystal Structure Of Human Nima-Related Kinase 1 (N 5e-23
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 6e-16
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 6e-16
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 1e-15
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 3e-14
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 2e-15
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 2e-15
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 3e-15
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 3e-15
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 3e-15
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 3e-15
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 3e-15
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 3e-15
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 3e-15
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 3e-15
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 3e-15
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 3e-15
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 5e-15
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 2e-13
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 6e-15
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 6e-15
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 6e-15
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 6e-15
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 7e-15
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 2e-13
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 1e-14
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 1e-14
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 1e-14
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 3e-13
3kk9_A282 Camkii Substrate Complex B Length = 282 2e-14
3kk9_A282 Camkii Substrate Complex B Length = 282 2e-14
3kk8_A284 Camkii Substrate Complex A Length = 284 2e-14
3kk8_A284 Camkii Substrate Complex A Length = 284 2e-14
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 2e-14
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 5e-13
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 2e-14
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 5e-13
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 2e-14
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 2e-14
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 2e-14
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 5e-13
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 2e-14
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 5e-13
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 2e-14
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 5e-13
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 2e-14
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 5e-13
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 2e-14
2bdw_A 362 Crystal Structure Of The Auto-Inhibited Kinase Doma 2e-14
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 2e-14
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 6e-13
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 2e-14
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 6e-13
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 2e-14
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 6e-13
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 2e-14
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 6e-13
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 2e-14
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 6e-13
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 2e-14
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 6e-13
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 2e-14
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 6e-13
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 2e-14
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 6e-13
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 2e-14
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 6e-13
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 4e-14
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 4e-14
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 5e-14
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 5e-14
3eqc_A360 X-Ray Structure Of The Human Mitogen-Activated Prot 6e-14
3eqc_A 360 X-Ray Structure Of The Human Mitogen-Activated Prot 6e-14
2y4i_C395 Ksr2-Mek1 Heterodimer Length = 395 7e-14
2y4i_C 395 Ksr2-Mek1 Heterodimer Length = 395 7e-14
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 7e-14
2w0j_A 323 Crystal Structure Of Chk2 In Complex With Nsc 10955 7e-14
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 7e-14
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 3e-13
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 7e-14
2xk9_A 322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 7e-14
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 7e-14
2ycr_A 323 Crystal Structure Of Checkpoint Kinase 2 In Complex 7e-14
1s9j_A341 X-Ray Structure Of The Human Mitogen-Activated Prot 7e-14
1s9j_A 341 X-Ray Structure Of The Human Mitogen-Activated Prot 7e-14
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 7e-14
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 7e-14
2p55_A333 X-Ray Structure Of The Human Mitogen-Activated Prot 7e-14
2p55_A 333 X-Ray Structure Of The Human Mitogen-Activated Prot 7e-14
3mbl_A328 Crystal Structure Of The Human Mitogen-Activated Pr 7e-14
3mbl_A 328 Crystal Structure Of The Human Mitogen-Activated Pr 7e-14
3dv3_A322 Mek1 With Pf-04622664 Bound Length = 322 7e-14
3dv3_A 322 Mek1 With Pf-04622664 Bound Length = 322 7e-14
3orn_A307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 8e-14
3orn_A 307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 8e-14
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 8e-14
2cn5_A 329 Crystal Structure Of Human Chk2 In Complex With Adp 8e-14
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 9e-14
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 9e-14
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 1e-13
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 1e-13
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 1e-13
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 5e-13
4an2_A301 Crystal Structures Of Human Mek1 With Carboxamide-B 2e-13
4an2_A301 Crystal Structures Of Human Mek1 With Carboxamide-B 2e-13
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 2e-13
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 2e-13
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 3e-13
3uc4_A 362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 3e-13
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 3e-13
3ujg_A 361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 3e-13
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 4e-13
3h4j_B 336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 4e-13
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 4e-13
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 4e-13
3bhy_A283 Crystal Structure Of Human Death Associated Protein 4e-13
3bhy_A283 Crystal Structure Of Human Death Associated Protein 4e-13
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 5e-13
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 5e-13
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 6e-13
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 6e-13
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 6e-13
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 6e-13
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 6e-13
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 6e-13
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 6e-13
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 6e-13
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 7e-13
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 7e-13
1s9i_A354 X-Ray Structure Of The Human Mitogen-Activated Prot 7e-13
1s9i_A 354 X-Ray Structure Of The Human Mitogen-Activated Prot 7e-13
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 8e-13
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 8e-13
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 9e-13
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 9e-13
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 1e-12
2wel_A 327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 1e-12
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-12
1bi8_A 326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-12
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 1e-12
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 1e-12
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 1e-12
3uc3_A 361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 1e-12
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 2e-12
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 2e-12
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 2e-12
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 1e-11
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-12
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-12
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 2e-12
2jc6_A 334 Crystal Structure Of Human Calmodulin-Dependent Pro 2e-12
3fv8_A355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 2e-12
3fv8_A 355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 5e-12
3fi3_A364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 2e-12
3fi3_A 364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 5e-12
3kvx_A364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 2e-12
3kvx_A 364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 5e-12
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 2e-12
2hak_A 328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 2e-12
2r9s_A356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 2e-12
2r9s_A 356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 5e-12
3fi2_A353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 2e-12
3fi2_A 353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 5e-12
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-12
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-12
2p3g_X327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 2e-12
2p3g_X 327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 2e-12
3fpm_A325 Crystal Structure Of A Squarate Inhibitor Bound To 2e-12
3fpm_A325 Crystal Structure Of A Squarate Inhibitor Bound To 2e-12
2pzy_A324 Structure Of Mk2 Complexed With Compound 76 Length 3e-12
2pzy_A324 Structure Of Mk2 Complexed With Compound 76 Length 3e-12
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 3e-12
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 3e-12
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 3e-12
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 3e-12
3r2y_A319 Mk2 Kinase Bound To Compound 1 Length = 319 3e-12
3r2y_A319 Mk2 Kinase Bound To Compound 1 Length = 319 3e-12
1kwp_A400 Crystal Structure Of Mapkap2 Length = 400 3e-12
1kwp_A 400 Crystal Structure Of Mapkap2 Length = 400 3e-12
3r2b_A318 Mk2 Kinase Bound To Compound 5b Length = 318 3e-12
3r2b_A318 Mk2 Kinase Bound To Compound 5b Length = 318 3e-12
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 3e-12
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 3e-12
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 3e-12
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 3e-12
2oza_A356 Structure Of P38alpha Complex Length = 356 3e-12
2oza_A 356 Structure Of P38alpha Complex Length = 356 3e-12
2jbo_A326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 3e-12
2jbo_A326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 3e-12
2onl_C406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 3e-12
2onl_C 406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 3e-12
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 3e-12
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 2e-11
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 3e-12
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 2e-11
3gok_A334 Binding Site Mapping Of Protein Ligands Length = 33 3e-12
3gok_A334 Binding Site Mapping Of Protein Ligands Length = 33 3e-12
3r1n_A317 Mk3 Kinase Bound To Compound 5b Length = 317 3e-12
3r1n_A 317 Mk3 Kinase Bound To Compound 5b Length = 317 3e-12
3ka0_A320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 3e-12
3ka0_A320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 3e-12
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 3e-12
3zut_A 362 The Structure Of Ost1 (D160a) Kinase Length = 362 3e-12
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 4e-12
3fhr_A 336 High Resolution Crystal Structure Of Mitogen-Activa 4e-12
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 4e-12
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 4e-12
3o17_A370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 4e-12
3o17_A 370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 1e-11
2exc_X356 Inhibitor Complex Of Jnk3 Length = 356 4e-12
2exc_X 356 Inhibitor Complex Of Jnk3 Length = 356 1e-11
2ok1_A365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 4e-12
2ok1_A 365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 1e-11
1pmn_A364 Crystal Structure Of Jnk3 In Complex With An Imidaz 4e-12
1pmn_A 364 Crystal Structure Of Jnk3 In Complex With An Imidaz 1e-11
3ptg_A363 Design And Synthesis Of A Novel, Orally Efficacious 4e-12
3ptg_A 363 Design And Synthesis Of A Novel, Orally Efficacious 1e-11
2o0u_A364 Crystal Structure Of Human Jnk3 Complexed With N-{3 5e-12
2o0u_A 364 Crystal Structure Of Human Jnk3 Complexed With N-{3 1e-11
3oxi_A362 Design And Synthesis Of Disubstituted Thiophene And 5e-12
3oxi_A 362 Design And Synthesis Of Disubstituted Thiophene And 1e-11
4h36_A356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 5e-12
4h36_A 356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 1e-11
2b1p_A355 Inhibitor Complex Of Jnk3 Length = 355 5e-12
2b1p_A 355 Inhibitor Complex Of Jnk3 Length = 355 1e-11
1jnk_A423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 5e-12
1jnk_A 423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 1e-11
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 5e-12
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 5e-12
3ttj_A464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 5e-12
3ttj_A 464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 1e-11
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 7e-12
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 5e-11
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 7e-12
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 5e-11
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 7e-12
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 7e-12
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 8e-12
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 8e-12
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 8e-12
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 8e-12
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 8e-12
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 5e-11
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 8e-12
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 5e-11
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 8e-12
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 5e-11
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 8e-12
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 5e-11
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 8e-12
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 5e-11
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 8e-12
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 5e-11
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 8e-12
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 5e-11
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 8e-12
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 8e-12
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 8e-12
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 5e-11
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 8e-12
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 5e-11
3lij_A 494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 8e-12
3lij_A 494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 8e-12
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 8e-12
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 5e-11
2g01_A370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 8e-12
2g01_A 370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 2e-11
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 9e-12
1a06_A 332 Calmodulin-Dependent Protein Kinase From Rat Length 9e-12
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 9e-12
3zuu_A 362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 9e-12
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 9e-12
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 6e-11
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 9e-12
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 9e-12
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 1e-11
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 7e-11
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 1e-11
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 6e-11
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 1e-11
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 6e-11
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 1e-11
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 6e-11
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 1e-11
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 6e-11
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-11
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 7e-11
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 1e-11
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 1e-11
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 1e-11
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 7e-11
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 1e-11
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 7e-11
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 1e-11
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 1e-11
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 1e-11
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 1e-11
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 1e-11
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 7e-11
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-11
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 7e-11
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 1e-11
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 1e-11
1nxk_A400 Crystal Structure Of Staurosporine Bound To Map Kap 1e-11
1nxk_A 400 Crystal Structure Of Staurosporine Bound To Map Kap 1e-11
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 1e-11
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 2e-11
3elj_A369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 1e-11
3elj_A 369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 3e-11
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-11
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-11
3pze_A358 Jnk1 In Complex With Inhibitor Length = 358 1e-11
3pze_A 358 Jnk1 In Complex With Inhibitor Length = 358 3e-11
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 1e-11
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 8e-11
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-11
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 1e-11
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 1e-11
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 1e-11
1koa_A 491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 1e-11
1koa_A 491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 1e-11
3rgf_A405 Crystal Structure Of Human Cdk8CYCC Length = 405 1e-11
3rgf_A 405 Crystal Structure Of Human Cdk8CYCC Length = 405 1e-11
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 1e-11
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 1e-11
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 1e-11
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 1e-11
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 1e-11
1fot_A 318 Structure Of The Unliganded Camp-Dependent Protein 1e-11
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 2e-11
2qnj_A 328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 2e-11
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 2e-11
3uto_A 573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 2e-11
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 2e-11
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 1e-10
2zmc_A390 Crystal Structure Of Human Mitotic Checkpoint Kinas 2e-11
2zmc_A 390 Crystal Structure Of Human Mitotic Checkpoint Kinas 2e-11
3cek_A313 Crystal Structure Of Human Dual Specificity Protein 2e-11
3cek_A313 Crystal Structure Of Human Dual Specificity Protein 2e-11
3hmn_A342 Crystal Structure Of Human Mps1 Catalytic Domain In 2e-11
3hmn_A342 Crystal Structure Of Human Mps1 Catalytic Domain In 2e-11
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 2e-11
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 2e-11
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 2e-11
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 2e-11
3dbq_A343 Crystal Structure Of Ttk Kinase Domain Length = 343 2e-11
3dbq_A 343 Crystal Structure Of Ttk Kinase Domain Length = 343 2e-11
2x9e_A317 Human Mps1 In Complex With Nms-P715 Length = 317 2e-11
2x9e_A317 Human Mps1 In Complex With Nms-P715 Length = 317 2e-11
3vqu_A320 Crystal Structure Of Human Mps1 Catalytic Domain In 2e-11
3vqu_A320 Crystal Structure Of Human Mps1 Catalytic Domain In 2e-11
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 2e-11
3fe3_A 328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 2e-11
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-11
1zmu_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-11
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-11
1zmv_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-11
3soa_A444 Full-Length Human Camkii Length = 444 2e-11
3soa_A 444 Full-Length Human Camkii Length = 444 2e-11
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 2e-11
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 2e-11
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 2e-11
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 2e-11
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 2e-11
3iec_A 319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 2e-11
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 2e-11
2r0i_A 327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 2e-11
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-11
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-11
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-11
1y8g_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-11
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 3e-11
2wzj_A 327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 3e-11
3uiu_A306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 3e-11
3uiu_A306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 3e-10
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 3e-11
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 3e-11
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 3e-11
3mfr_A 351 Cask-4m Cam Kinase Domain, Native Length = 351 3e-11
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 3e-11
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 3e-11
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-11
1zmw_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 3e-11
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 3e-11
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 2e-10
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 3e-11
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 1e-10
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 3e-11
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 3e-11
3eb0_A383 Crystal Structure Of Cgd4_240 From Cryptosporidium 3e-11
3eb0_A 383 Crystal Structure Of Cgd4_240 From Cryptosporidium 4e-11
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 3e-11
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 2e-10
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 3e-11
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 3e-11
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 3e-11
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 3e-11
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 4e-11
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 4e-11
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 4e-11
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 4e-11
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 4e-11
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 4e-11
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 4e-11
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 4e-11
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 4e-11
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 4e-11
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 4e-11
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 4e-11
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 4e-11
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 4e-11
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 5e-11
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 5e-11
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 5e-11
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 5e-11
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 5e-11
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 5e-11
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 5e-11
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 5e-11
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 5e-11
2pk9_A 317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 5e-11
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 5e-11
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 5e-11
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 5e-11
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 5e-11
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 5e-11
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 5e-11
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 5e-11
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 5e-11
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 5e-11
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 5e-11
3f5u_A295 Crystal Structure Of The Death Associated Protein K 5e-11
3f5u_A295 Crystal Structure Of The Death Associated Protein K 5e-11
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 5e-11
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 5e-11
3hzt_A 467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 5e-11
3hzt_A 467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 5e-11
3q5i_A 504 Crystal Structure Of Pbanka_031420 Length = 504 6e-11
3q5i_A 504 Crystal Structure Of Pbanka_031420 Length = 504 6e-11
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 6e-11
2xuu_A 334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 6e-11
4bcf_A331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 6e-11
4bcf_A331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 6e-11
3sa0_A360 Complex Of Erk2 With Norathyriol Length = 360 6e-11
3sa0_A 360 Complex Of Erk2 With Norathyriol Length = 360 3e-10
3h9f_A313 Crystal Structure Of Human Dual Specificity Protein 6e-11
3h9f_A313 Crystal Structure Of Human Dual Specificity Protein 6e-11
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 6e-11
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 6e-11
2zmd_A390 Crystal Structure Of Human Mps1 Catalytic Domain T6 6e-11
2zmd_A 390 Crystal Structure Of Human Mps1 Catalytic Domain T6 6e-11
3c4w_A543 Crystal Structure Of G Protein Coupled Receptor Kin 6e-11
3c4w_A 543 Crystal Structure Of G Protein Coupled Receptor Kin 6e-11
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 6e-11
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 3e-10
3blh_A331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 6e-11
3blh_A331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 6e-11
3c4x_A543 Crystal Structure Of G Protein Coupled Receptor Kin 6e-11
3c4x_A 543 Crystal Structure Of G Protein Coupled Receptor Kin 6e-11
3t8o_A543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 6e-11
3t8o_A 543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 6e-11
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 6e-11
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 3e-10
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 6e-11
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 6e-11
4ec8_A373 Structure Of Full Length Cdk9 In Complex With Cycli 6e-11
4ec8_A 373 Structure Of Full Length Cdk9 In Complex With Cycli 7e-11
3mi9_A351 Crystal Structure Of Hiv-1 Tat Complexed With Human 7e-11
3mi9_A 351 Crystal Structure Of Hiv-1 Tat Complexed With Human 7e-11
3qc9_A543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 7e-11
3qc9_A 543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 7e-11
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 7e-11
2x0g_A 334 X-ray Structure Of A Dap-kinase Calmodulin Complex 7e-11
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 7e-11
2y0a_A 326 Structure Of Dapk1 Construct Residues 1-304 Length 7e-11
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 7e-11
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 7e-11
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 7e-11
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 7e-11
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 7e-11
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 7e-11
2r5t_A373 Crystal Structure Of Inactive Serum And Glucocortic 7e-11
2r5t_A 373 Crystal Structure Of Inactive Serum And Glucocortic 7e-11
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 7e-11
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 7e-11
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 7e-11
3kn5_A 325 Crystal Structure Of The C-Terminal Kinase Domain O 2e-10
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 8e-11
2qr8_A 342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 8e-11
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 8e-11
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 8e-11
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 8e-11
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 8e-11
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 8e-11
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 8e-11
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 8e-11
2acx_A 576 Crystal Structure Of G Protein Coupled Receptor Kin 8e-11
1ua2_A346 Crystal Structure Of Human Cdk7 Length = 346 8e-11
1ua2_A 346 Crystal Structure Of Human Cdk7 Length = 346 8e-11
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 8e-11
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 8e-11
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 9e-11
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 9e-11
4fv7_A360 Crystal Structure Of The Erk2 Complexed With E94 Le 9e-11
4fv7_A 360 Crystal Structure Of The Erk2 Complexed With E94 Le 5e-10
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 9e-11
3nyn_A 576 Crystal Structure Of G Protein-Coupled Receptor Kin 9e-11
4gsb_A364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 9e-11
4gsb_A 364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 5e-10
4h3q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 9e-11
4h3q_A 362 Crystal Structure Of Human Erk2 Complexed With A Ma 5e-10
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 9e-11
4agu_A 311 Crystal Structure Of The Human Cdkl1 Kinase Domain 9e-11
3qyw_A364 Crystal Structure Of Erk2 In Complex With An Inhibi 9e-11
3qyw_A 364 Crystal Structure Of Erk2 In Complex With An Inhibi 5e-10
4fux_A360 Crystal Structure Of The Erk2 Complexed With E75 Le 9e-11
4fux_A 360 Crystal Structure Of The Erk2 Complexed With E75 Le 5e-10
3mtl_A324 Crystal Structure Of The Pctaire1 Kinase In Complex 1e-10
3mtl_A 324 Crystal Structure Of The Pctaire1 Kinase In Complex 1e-10
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 1e-10
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 4e-10
1pme_A380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 1e-10
1pme_A 380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 6e-10
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-10
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-10
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 1e-10
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 4e-10
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 1e-10
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 1e-10
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 1e-10
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 1e-10
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 1e-10
2ya9_A 361 Crystal Structure Of The Autoinhibited Form Of Mous 1e-10
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 1e-10
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 1e-10
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 1e-10
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 1e-10
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 1e-10
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 1e-10
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-10
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 1e-10
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 1e-10
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 1e-10
3a7f_A303 Human Mst3 Kinase Length = 303 1e-10
3a7f_A303 Human Mst3 Kinase Length = 303 1e-10
4dc2_A396 Structure Of Pkc In Complex With A Substrate Peptid 2e-10
4dc2_A 396 Structure Of Pkc In Complex With A Substrate Peptid 2e-10
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 2e-10
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 2e-10
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 2e-10
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 2e-10
4fie_A423 Full-Length Human Pak4 Length = 423 2e-10
4fie_A423 Full-Length Human Pak4 Length = 423 3e-10
1xjd_A345 Crystal Structure Of Pkc-Theta Complexed With Staur 2e-10
1xjd_A 345 Crystal Structure Of Pkc-Theta Complexed With Staur 2e-10
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 2e-10
2jed_A 352 The Crystal Structure Of The Kinase Domain Of The P 2e-10
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 2e-10
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 2e-10
2v55_A406 Mechanism Of Multi-site Phosphorylation From A Rock 2e-10
2v55_A 406 Mechanism Of Multi-site Phosphorylation From A Rock 2e-10
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 2e-10
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 2e-10
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 2e-10
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 2e-10
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 2e-10
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 3e-10
2a19_B284 Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng 2e-10
2a19_B284 Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng 2e-09
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 2e-10
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 2e-10
1wzy_A368 Crystal Structure Of Human Erk2 Complexed With A Py 2e-10
1wzy_A 368 Crystal Structure Of Human Erk2 Complexed With A Py 1e-09
1tvo_A368 The Structure Of Erk2 In Complex With A Small Molec 2e-10
1tvo_A 368 The Structure Of Erk2 In Complex With A Small Molec 1e-09
3zuv_A364 Crystal Structure Of A Designed Selected Ankyrin Re 2e-10
3zuv_A 364 Crystal Structure Of A Designed Selected Ankyrin Re 1e-09
2erk_A365 Phosphorylated Map Kinase Erk2 Length = 365 2e-10
2erk_A 365 Phosphorylated Map Kinase Erk2 Length = 365 1e-09
3zu7_A365 Crystal Structure Of A Designed Selected Ankyrin Re 2e-10
3zu7_A 365 Crystal Structure Of A Designed Selected Ankyrin Re 1e-09
2z7l_A366 Unphosphorylated Mitogen Activated Protein Kinase E 2e-10
2z7l_A 366 Unphosphorylated Mitogen Activated Protein Kinase E 1e-09
3c9w_A357 Crystal Structure Of Erk-2 With Hypothemycin Covale 2e-10
3c9w_A 357 Crystal Structure Of Erk-2 With Hypothemycin Covale 1e-09
2fys_B364 Crystal Structure Of Erk2 Complex With Kim Peptide 2e-10
2fys_B 364 Crystal Structure Of Erk2 Complex With Kim Peptide 1e-09
1gol_A364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 2e-10
1gol_A 364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 1e-09
2y9q_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 2e-10
2y9q_A 362 Crystal Structure Of Human Erk2 Complexed With A Ma 1e-09
3v8s_A410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 2e-10
3v8s_A 410 Human Rho-Associated Protein Kinase 1 (Rock 1) In C 2e-10
3r63_A358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 2e-10
3r63_A 358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 1e-09
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 2e-10
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 2e-10
2esm_A415 Crystal Structure Of Rock 1 Bound To Fasudil Length 2e-10
2esm_A 415 Crystal Structure Of Rock 1 Bound To Fasudil Length 2e-10
3tei_A362 Crystal Structure Of Human Erk2 Complexed With A Ma 2e-10
3tei_A 362 Crystal Structure Of Human Erk2 Complexed With A Ma 1e-09
3o71_A358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 2e-10
3o71_A 358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 1e-09
4fv6_A360 Crystal Structure Of The Erk2 Complexed With E57 Le 2e-10
4fv6_A 360 Crystal Structure Of The Erk2 Complexed With E57 Le 1e-09
2ojg_A380 Crystal Structure Of Erk2 In Complex With N,n-dimet 2e-10
2ojg_A 380 Crystal Structure Of Erk2 In Complex With N,n-dimet 1e-09
2gph_A364 Docking Motif Interactions In The Map Kinase Erk2 L 2e-10
2gph_A 364 Docking Motif Interactions In The Map Kinase Erk2 L 1e-09
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 2e-10
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 2e-10
3g51_A325 Structural Diversity Of The Active Conformation Of 3e-10
3g51_A325 Structural Diversity Of The Active Conformation Of 3e-10
1zrz_A364 Crystal Structure Of The Catalytic Domain Of Atypic 3e-10
1zrz_A 364 Crystal Structure Of The Catalytic Domain Of Atypic 3e-10
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 3e-10
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 3e-10
3zh8_A349 A Novel Small Molecule Apkc Inhibitor Length = 349 3e-10
3zh8_A 349 A Novel Small Molecule Apkc Inhibitor Length = 349 3e-10
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 3e-10
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 3e-10
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 3e-10
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 3e-10
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 3e-10
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 3e-10
3a8w_A345 Crystal Structure Of Pkciota Kinase Domain Length = 3e-10
3a8w_A 345 Crystal Structure Of Pkciota Kinase Domain Length = 3e-10
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 3e-10
2qr7_A 342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 3e-10
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 3e-10
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 3e-10
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 3e-10
3ama_A 351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 3e-10
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 3e-10
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 3e-10
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 3e-10
2gnj_A 350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 3e-10
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 3e-10
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 3e-10
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-10
2gng_A 350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-10
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-10
2gnf_A 350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-10
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 3e-10
3fhi_A 350 Crystal Structure Of A Complex Between The Catalyti 3e-10
2zoq_A382 Structural Dissection Of Human Mitogen-Activated Ki 4e-10
2zoq_A 382 Structural Dissection Of Human Mitogen-Activated Ki 2e-09
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 4e-10
1xh9_A 350 Crystal Structures Of Protein Kinase B Selective In 4e-10
3e7o_A360 Crystal Structure Of Jnk2 Length = 360 4e-10
3e7o_A 360 Crystal Structure Of Jnk2 Length = 360 4e-10
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 4e-10
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 4e-10
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 4e-10
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 4e-10
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 4e-10
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 4e-10
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 4e-10
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 4e-10
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 4e-10
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 4e-10
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 4e-10
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 4e-10
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 4e-10
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 4e-10
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 4e-10
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 4e-10
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 5e-10
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 5e-10
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 5e-10
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 5e-10
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 5e-10
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 5e-10
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 5e-10
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 5e-10
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 5e-10
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 5e-10
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 5e-10
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 5e-10
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 5e-10
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 5e-10
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 5e-10
1j3h_A 350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 5e-10
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 5e-10
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 5e-10
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 5e-10
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 5e-10
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 5e-10
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 5e-10
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 5e-10
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 5e-10
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 5e-10
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 5e-10
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 5e-10
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 5e-10
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 5e-10
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 5e-10
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 5e-10
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 5e-10
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 5e-10
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 5e-10
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 5e-10
2uzt_A 336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 5e-10
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 5e-10
2f7e_E 351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 5e-10
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 5e-10
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 5e-10
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 5e-10
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 5e-10
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 5e-10
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 5e-10
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 5e-10
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 5e-10
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 5e-10
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 5e-10
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 5e-10
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 5e-10
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 5e-10
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 5e-10
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 5e-10
1szm_A 350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 5e-10
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 5e-10
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 5e-10
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 5e-10
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 5e-10
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 5e-10
3l9m_A 351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 5e-10
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 5e-10
1q61_A 350 Pka Triple Mutant Model Of Pkb Length = 350 5e-10
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 5e-10
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 5e-10
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 5e-10
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 5e-10
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 5e-10
2vo0_A 351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 5e-10
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 5e-10
2uvy_A 351 Structure Of Pka-pkb Chimera Complexed With Methyl- 5e-10
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 5e-10
2jdt_A 351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 5e-10
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 5e-10
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 5e-10
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 5e-10
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 5e-10
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 6e-10
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 6e-10
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 6e-10
4dfy_A 371 Crystal Structure Of R194a Mutant Of Camp-Dependent 6e-10
3vuk_A370 Crystal Structure Of A Cysteine-deficient Mutant M5 7e-10
3vuk_A 370 Crystal Structure Of A Cysteine-deficient Mutant M5 7e-10
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 7e-10
1l3r_E 350 Crystal Structure Of A Transition State Mimic Of Th 7e-10
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 7e-10
1apm_E 350 2.0 Angstrom Refined Crystal Structure Of The Catal 7e-10
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 7e-10
2erz_E 351 Crystal Structure Of C-amp Dependent Kinase (pka) B 7e-10
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 7e-10
2wnt_A 330 Crystal Structure Of The Human Ribosomal Protein S6 7e-10
3vuh_A370 Crystal Structure Of A Cysteine-deficient Mutant M3 7e-10
3vuh_A 370 Crystal Structure Of A Cysteine-deficient Mutant M3 7e-10
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 7e-10
3rny_A 346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 7e-10
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 7e-10
3qal_E 350 Crystal Structure Of Arg280ala Mutant Of Catalytic 7e-10
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 7e-10
3nx8_A 351 Human Camp Dependent Protein Kinase In Complex With 7e-10
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 7e-10
3agl_A 351 Complex Of Pka With The Bisubstrate Protein Kinase 7e-10
2qcs_A350 A Complex Structure Between The Catalytic And Regul 7e-10
2qcs_A 350 A Complex Structure Between The Catalytic And Regul 7e-10
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 7e-10
2gu8_A 337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 7e-10
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 7e-10
1bkx_A 350 A Binary Complex Of The Catalytic Subunit Of Camp-D 7e-10
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 7e-10
3dnd_A 350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 7e-10
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 7e-10
1ydt_E 350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 7e-10
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 7e-10
1svh_A 350 Crystal Structure Of Protein Kinase A In Complex Wi 7e-10
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 7e-10
1q8w_A 350 The Catalytic Subunit Of Camp-Dependent Protein Kin 7e-10
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 7e-10
2qur_A 350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 7e-10
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 7e-10
1stc_E 350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 7e-10
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 7e-10
4dg3_E 371 Crystal Structure Of R336a Mutant Of Camp-dependent 7e-10
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 7e-10
4dfx_E 350 Crystal Structure Of Myristoylated K7c Catalytic Su 7e-10
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 7e-10
1jbp_E 350 Crystal Structure Of The Catalytic Subunit Of Camp- 7e-10
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 7e-10
1fmo_E 350 Crystal Structure Of A Polyhistidine-Tagged Recombi 7e-10
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 7e-10
3pvb_A 345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 7e-10
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 7e-10
1xh7_A 350 Crystal Structures Of Protein Kinase B Selective In 7e-10
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 8e-10
3agm_A 351 Complex Of Pka With The Bisubstrate Protein Kinase 8e-10
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 8e-10
1cmk_E 350 Crystal Structures Of The Myristylated Catalytic Su 8e-10
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 8e-10
2jds_A 351 Structure Of Camp-Dependent Protein Kinase Complexe 8e-10
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 8e-10
2c1a_A 351 Structure Of Camp-Dependent Protein Kinase Complexe 8e-10
3vui_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 8e-10
3vui_A 370 Crystal Structure Of A Cysteine-deficient Mutant M2 8e-10
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 8e-10
1gzk_A 315 Molecular Mechanism For The Regulation Of Protein K 8e-10
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 8e-10
1cdk_A 350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 8e-10
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 8e-10
3mvj_A 371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 8e-10
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 8e-10
1ctp_E 350 Structure Of The Mammalian Catalytic Subunit Of Cam 8e-10
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 8e-10
1syk_A 350 Crystal Structure Of E230q Mutant Of Camp-Dependent 8e-10
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 8e-10
1mrv_A 339 Crystal Structure Of An Inactive Akt2 Kinase Domain 8e-10
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 8e-10
1gzn_A 335 Structure Of Pkb Kinase Domain Length = 335 8e-10
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 8e-10
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 8e-10
4ae9_A343 Structure And Function Of The Human Sperm-specific 8e-10
4ae9_A 343 Structure And Function Of The Human Sperm-specific 8e-10
4ae6_A343 Structure And Function Of The Human Sperm-specific 9e-10
4ae6_A 343 Structure And Function Of The Human Sperm-specific 9e-10
1smh_A350 Protein Kinase A Variant Complex With Completely Or 9e-10
1smh_A 350 Protein Kinase A Variant Complex With Completely Or 9e-10
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 1e-09
3iw4_A 360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 1e-09
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 1e-09
2jdo_A 342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 1e-09
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 1e-09
1o6l_A 337 Crystal Structure Of An Activated Akt/protein Kinas 1e-09
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 1e-09
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 1e-09
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 1e-09
1q24_A 350 Pka Double Mutant Model Of Pkb In Complex With Mgat 1e-09
1tki_A321 Autoinhibited Serine Kinase Domain Of The Giant Mus 1e-09
1tki_A 321 Autoinhibited Serine Kinase Domain Of The Giant Mus 1e-09
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 1e-09
3e87_A 335 Crystal Structures Of The Kinase Domain Of Akt2 In 1e-09
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 1e-09
1o6k_A 336 Structure Of Activated Form Of Pkb Kinase Domain S4 1e-09
3qd2_B332 Crsytal Structure Of Mouse Perk Kinase Domain Lengt 1e-09
3qd2_B332 Crsytal Structure Of Mouse Perk Kinase Domain Lengt 1e-09
2xs0_A386 Linear Binding Motifs For Jnk And For Calcineurin A 1e-09
2xs0_A 386 Linear Binding Motifs For Jnk And For Calcineurin A 1e-09
2xrw_A371 Linear Binding Motifs For Jnk And For Calcineurin A 1e-09
2xrw_A 371 Linear Binding Motifs For Jnk And For Calcineurin A 1e-09
1ukh_A369 Structural Basis For The Selective Inhibition Of Jn 2e-09
1ukh_A 369 Structural Basis For The Selective Inhibition Of Jn 2e-09
3npc_A364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 2e-09
3npc_A 364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 2e-09
3vug_A370 Crystal Structure Of A Cysteine-deficient Mutant M2 2e-09
3vug_A 370 Crystal Structure Of A Cysteine-deficient Mutant M2 2e-09
3vud_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 2e-09
3vud_A 370 Crystal Structure Of A Cysteine-deficient Mutant M1 2e-09
4e7w_A394 Structure Of Gsk3 From Ustilago Maydis Length = 394 2e-09
4e7w_A 394 Structure Of Gsk3 From Ustilago Maydis Length = 394 2e-09
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 2e-09
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 2e-09
3v3v_A379 Structural And Functional Analysis Of Quercetagetin 2e-09
3v3v_A 379 Structural And Functional Analysis Of Quercetagetin 2e-09
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 2e-09
3tac_A 361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 2e-09
2f2u_A402 Crystal Structure Of The Rho-Kinase Kinase Domain L 2e-09
2f2u_A 402 Crystal Structure Of The Rho-Kinase Kinase Domain L 2e-09
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 2e-09
3c0g_A 351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 2e-09
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 3e-09
4aaa_A 331 Crystal Structure Of The Human Cdkl2 Kinase Domain 3e-09
2wtk_C305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 3e-09
2wtk_C305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 3e-09
2vx3_A382 Crystal Structure Of The Human Dual Specificity Tyr 3e-09
2vx3_A 382 Crystal Structure Of The Human Dual Specificity Tyr 3e-09
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 3e-09
3o7l_B 350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 3e-09
3anq_A368 Human Dyrk1aINHIBITOR COMPLEX Length = 368 3e-09
3anq_A 368 Human Dyrk1aINHIBITOR COMPLEX Length = 368 3e-09
1cm8_A367 Phosphorylated Map Kinase P38-Gamma Length = 367 3e-09
1cm8_A 367 Phosphorylated Map Kinase P38-Gamma Length = 367 7e-09
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 4e-09
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 4e-09
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 4e-09
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 4e-09
4aze_A382 Human Dyrk1a In Complex With Leucettine L41 Length 4e-09
4aze_A 382 Human Dyrk1a In Complex With Leucettine L41 Length 4e-09
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 5e-09
3qam_E 350 Crystal Structure Of Glu208ala Mutant Of Catalytic 5e-09
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 5e-09
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 5e-09
3vum_A370 Crystal Structure Of A Cysteine-deficient Mutant M7 6e-09
3vum_A 370 Crystal Structure Of A Cysteine-deficient Mutant M7 6e-09
2y8o_A362 Crystal Structure Of Human P38alpha Complexed With 7e-09
2y8o_A 362 Crystal Structure Of Human P38alpha Complexed With 1e-08
1ove_A366 The Structure Of P38 Alpha In Complex With A Dihydr 7e-09
1ove_A 366 The Structure Of P38 Alpha In Complex With A Dihydr 1e-08
3vul_A370 Crystal Structure Of A Cysteine-deficient Mutant M1 7e-09
3vul_A 370 Crystal Structure Of A Cysteine-deficient Mutant M1 7e-09
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 7e-09
2i0e_A 353 Structure Of Catalytic Domain Of Human Protein Kina 7e-09
4g3c_A352 Crystal Structure Of Apo Murine Nf-kappab Inducing 7e-09
4g3c_A352 Crystal Structure Of Apo Murine Nf-kappab Inducing 7e-09
4g3f_A336 Crystal Structure Of Murine Nf-kappab Inducing Kina 7e-09
4g3f_A336 Crystal Structure Of Murine Nf-kappab Inducing Kina 7e-09
4g3g_A350 Crystal Structure Of Murine Nf-kappab Inducing Kina 8e-09
4g3g_A350 Crystal Structure Of Murine Nf-kappab Inducing Kina 8e-09
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 8e-09
1rdq_E 350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 8e-09
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 8e-09
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 1e-08
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 8e-09
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 8e-09
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 9e-09
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 9e-09
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 9e-09
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 1e-08
3d83_A360 Crystal Structure Of P38 Kinase In Complex With A B 9e-09
3d83_A 360 Crystal Structure Of P38 Kinase In Complex With A B 1e-08
2bal_A365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 1e-08
2bal_A 365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 1e-08
2baq_A365 P38alpha Bound To Ro3201195 Length = 365 1e-08
2baq_A 365 P38alpha Bound To Ro3201195 Length = 365 1e-08
3e92_A371 Crystal Structure Of P38 Kinase In Complex With A B 1e-08
3e92_A 371 Crystal Structure Of P38 Kinase In Complex With A B 2e-08
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 1e-08
1kob_A 387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 1e-08
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 1e-08
3qfv_A 415 Mrck Beta In Complex With Tpca-1 Length = 415 1e-08
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 1e-08
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 1e-08
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 1e-08
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 1e-08
2i6l_A320 Crystal Structure Of Human Mitogen Activated Protei 1e-08
2i6l_A320 Crystal Structure Of Human Mitogen Activated Protei 1e-08
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 1e-08
3tku_A 433 Mrck Beta In Complex With Fasudil Length = 433 1e-08
3txo_A353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 1e-08
3txo_A 353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 1e-08
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 1e-08
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 1e-08
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 1e-08
3pfq_A 674 Crystal Structure And Allosteric Activation Of Prot 1e-08
4fst_A269 Crystal Structure Of The Chk1 Length = 269 1e-08
4fst_A269 Crystal Structure Of The Chk1 Length = 269 1e-08
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 1e-08
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 1e-08
2ow3_A352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 1e-08
2ow3_A 352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 1e-08
3zdi_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 1e-08
3zdi_A 350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 1e-08
1o9u_A350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 1e-08
1o9u_A 350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 1e-08
4dit_A382 Crystal Structure Of Gsk3beta In Complex With A Imi 1e-08
4dit_A 382 Crystal Structure Of Gsk3beta In Complex With A Imi 1e-08
3gb2_A353 Gsk3beta Inhibitor Complex Length = 353 1e-08
3gb2_A 353 Gsk3beta Inhibitor Complex Length = 353 1e-08
3f7z_A350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 1e-08
3f7z_A 350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 1e-08
1h8f_A352 Glycogen Synthase Kinase 3 Beta. Length = 352 1e-08
1h8f_A 352 Glycogen Synthase Kinase 3 Beta. Length = 352 1e-08
3f88_A349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 1e-08
3f88_A 349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 1e-08
3zrk_A371 Identification Of 2-(4-Pyridyl)thienopyridinones As 1e-08
3zrk_A 371 Identification Of 2-(4-Pyridyl)thienopyridinones As 1e-08
1gng_A378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 1e-08
1gng_A 378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 1e-08
4afj_A367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 1e-08
4afj_A 367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 1e-08
4e5a_X360 The W197a Mutant Of P38a Map Kinase Length = 360 1e-08
4e5a_X 360 The W197a Mutant Of P38a Map Kinase Length = 360 2e-08
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 1e-08
4gs6_A 315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 1e-08
1uv5_A350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 1e-08
1uv5_A 350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 1e-08
2o5k_A372 Crystal Structure Of Gsk3beta In Complex With A Ben 2e-08
2o5k_A 372 Crystal Structure Of Gsk3beta In Complex With A Ben 2e-08
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 2e-08
2eva_A 307 Structural Basis For The Interaction Of Tak1 Kinase 2e-08
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 2e-08
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 2e-08
3say_A430 Crystal Structure Of Human Glycogen Synthase Kinase 2e-08
3say_A 430 Crystal Structure Of Human Glycogen Synthase Kinase 2e-08
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 2e-08
4gv1_A 340 Pkb Alpha In Complex With Azd5363 Length = 340 2e-08
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 2e-08
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 2e-08
3sd0_A350 Identification Of A Glycogen Synthase Kinase-3b Inh 2e-08
3sd0_A 350 Identification Of A Glycogen Synthase Kinase-3b Inh 2e-08
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 2e-08
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 2e-08
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 2e-08
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 2e-08
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 2e-08
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 2e-08
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 2e-08
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 2e-08
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 2e-08
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 2e-08
1r0e_A391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 2e-08
1r0e_A 391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 2e-08
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 2e-08
3ocb_A 341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 2e-08
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 2e-08
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 2e-08
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 2e-08
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 2e-08
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 2e-08
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 2e-08
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 2e-08
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 2e-08
1yw2_A360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 2e-08
1yw2_A 360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 2e-08
1q5k_A414 Crystal Structure Of Glycogen Synthase Kinase 3 In 2e-08
1q5k_A 414 Crystal Structure Of Glycogen Synthase Kinase 3 In 2e-08
1i09_A420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 2e-08
1i09_A 420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 2e-08
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 2e-08
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 2e-08
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 2e-08
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 2e-08
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 2e-08
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 2e-08
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 2e-08
3cqu_A 342 Crystal Structure Of Akt-1 Complexed With Substrate 2e-08
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 2e-08
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 2e-08
1ywr_A360 Crystal Structure Analysis Of Inactive P38 Kinase D 2e-08
1ywr_A 360 Crystal Structure Analysis Of Inactive P38 Kinase D 2e-08
3gcp_A360 Human P38 Map Kinase In Complex With Sb203580 Lengt 2e-08
3gcp_A 360 Human P38 Map Kinase In Complex With Sb203580 Lengt 3e-08
1pyx_A422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 2e-08
1pyx_A 422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 2e-08
3e3p_A360 Glycogen Synthase Kinase From Leishmania Major Leng 2e-08
3e3p_A 360 Glycogen Synthase Kinase From Leishmania Major Leng 2e-08
4acc_A465 Gsk3b In Complex With Inhibitor Length = 465 2e-08
4acc_A 465 Gsk3b In Complex With Inhibitor Length = 465 2e-08
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 2e-08
2r0u_A 323 Crystal Structure Of Chek1 In Complex With Inhibito 2e-08
2ghl_A348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 2e-08
2ghl_A 348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 3e-08
3oht_A389 Crystal Structure Of Salmo Salar P38alpha Length = 2e-08
3oht_A 389 Crystal Structure Of Salmo Salar P38alpha Length = 2e-08
1q3d_A424 Gsk-3 Beta Complexed With Staurosporine Length = 42 2e-08
1q3d_A 424 Gsk-3 Beta Complexed With Staurosporine Length = 42 2e-08
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 2e-08
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 2e-08
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 2e-08
2hog_A 322 Crystal Structure Of Chek1 In Complex With Inhibito 2e-08
3py3_A380 Crystal Structure Of Phosphorylated P38alpha Map Ki 2e-08
3py3_A 380 Crystal Structure Of Phosphorylated P38alpha Map Ki 3e-08
2fso_X367 Mitogen Activated Protein Kinase P38alpha (D176a) A 2e-08
2fso_X 367 Mitogen Activated Protein Kinase P38alpha (D176a) A 3e-08
2fst_X367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 2e-08
2fst_X 367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 3e-08
2fsl_X367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 2e-08
2fsl_X 367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 3e-08
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 2e-08
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 2e-08
1ian_A366 Human P38 Map Kinase Inhibitor Complex Length = 366 2e-08
1ian_A 366 Human P38 Map Kinase Inhibitor Complex Length = 366 3e-08
3nnx_A354 Crystal Structure Of Phosphorylated P38 Alpha In Co 2e-08
3nnx_A 354 Crystal Structure Of Phosphorylated P38 Alpha In Co 3e-08
1oz1_A372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 2e-08
1oz1_A 372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 3e-08
4ewq_A383 Human P38 Alpha Mapk In Complex With A Pyridazine B 2e-08
4ewq_A 383 Human P38 Alpha Mapk In Complex With A Pyridazine B 3e-08
2gfs_A372 P38 Kinase Crystal Structure In Complex With Ro3201 2e-08
2gfs_A 372 P38 Kinase Crystal Structure In Complex With Ro3201 3e-08
1m7q_A366 Crystal Structure Of P38 Map Kinase In Complex With 2e-08
1m7q_A 366 Crystal Structure Of P38 Map Kinase In Complex With 3e-08
3p4k_A370 The Third Conformation Of P38a Map Kinase Observed 2e-08
3p4k_A 370 The Third Conformation Of P38a Map Kinase Observed 3e-08
3mpt_A371 Crystal Structure Of P38 Kinase In Complex With A P 2e-08
3mpt_A 371 Crystal Structure Of P38 Kinase In Complex With A P 3e-08
3k3j_A362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 2e-08
3k3j_A 362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 3e-08
3dt1_A383 P38 Complexed With A Quinazoline Inhibitor Length = 2e-08
3dt1_A 383 P38 Complexed With A Quinazoline Inhibitor Length = 3e-08
2oza_B366 Structure Of P38alpha Complex Length = 366 2e-08
2oza_B 366 Structure Of P38alpha Complex Length = 366 4e-08
3ody_X360 Crystal Structure Of P38alpha Y323q Active Mutant L 2e-08
3ody_X 360 Crystal Structure Of P38alpha Y323q Active Mutant L 3e-08
2baj_A365 P38alpha Bound To Pyrazolourea Length = 365 2e-08
2baj_A 365 P38alpha Bound To Pyrazolourea Length = 365 3e-08
3fi4_A372 P38 Kinase Crystal Structure In Complex With Ro4499 2e-08
3fi4_A 372 P38 Kinase Crystal Structure In Complex With Ro4499 4e-08
3hrb_A359 P38 Kinase Crystal Structure In Complex With Small 2e-08
3hrb_A 359 P38 Kinase Crystal Structure In Complex With Small 3e-08
3gcu_A360 Human P38 Map Kinase In Complex With Rl48 Length = 2e-08
3gcu_A 360 Human P38 Map Kinase In Complex With Rl48 Length = 3e-08
1lew_A360 Crystal Structure Of Map Kinase P38 Complexed To Th 2e-08
1lew_A 360 Crystal Structure Of Map Kinase P38 Complexed To Th 3e-08
3zsg_A362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 2e-08
3zsg_A 362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 4e-08
2npq_A367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 2e-08
2npq_A 367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 3e-08
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 2e-08
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 2e-08
3d7z_A360 Crystal Structure Of P38 Kinase In Complex With A B 2e-08
3d7z_A 360 Crystal Structure Of P38 Kinase In Complex With A B 3e-08
1di9_A360 The Structure Of P38 Mitogen-Activated Protein Kina 2e-08
1di9_A 360 The Structure Of P38 Mitogen-Activated Protein Kina 3e-08
3s3i_A349 P38 Kinase Crystal Structure In Complex With Small 2e-08
3s3i_A 349 P38 Kinase Crystal Structure In Complex With Small 3e-08
3tg1_A380 Crystal Structure Of P38alpha In Complex With A Map 2e-08
3tg1_A 380 Crystal Structure Of P38alpha In Complex With A Map 4e-08
3odz_X360 Crystal Structure Of P38alpha Y323r Active Mutant L 2e-08
3odz_X 360 Crystal Structure Of P38alpha Y323r Active Mutant L 3e-08
3od6_X360 Crystal Structure Of P38alpha Y323t Active Mutant L 2e-08
3od6_X 360 Crystal Structure Of P38alpha Y323t Active Mutant L 3e-08
3kq7_A380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 2e-08
3kq7_A 380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 4e-08
1bmk_A379 The Complex Structure Of The Map Kinase P38SB218655 2e-08
1bmk_A 379 The Complex Structure Of The Map Kinase P38SB218655 4e-08
2lgc_A359 Joint Nmr And X-Ray Refinement Reveals The Structur 2e-08
2lgc_A 359 Joint Nmr And X-Ray Refinement Reveals The Structur 3e-08
1bl6_A379 The Complex Structure Of The Map Kinase P38SB216995 2e-08
1bl6_A 379 The Complex Structure Of The Map Kinase P38SB216995 4e-08
3gc9_A370 The Structure Of P38beta C119s, C162s In Complex Wi 2e-08
3gc9_A 370 The Structure Of P38beta C119s, C162s In Complex Wi 1e-07
1zzl_A351 Crystal Structure Of P38 With Triazolopyridine Leng 3e-08
1zzl_A 351 Crystal Structure Of P38 With Triazolopyridine Leng 3e-08
3hvc_A362 Crystal Structure Of Human P38alpha Map Kinase Leng 3e-08
3hvc_A 362 Crystal Structure Of Human P38alpha Map Kinase Leng 4e-08
3gc8_A370 The Structure Of P38beta C162s In Complex With A Di 3e-08
3gc8_A 370 The Structure Of P38beta C162s In Complex With A Di 1e-07
2gtm_A348 Mutated Mouse P38 Map Kinase Domain In Complex With 3e-08
2gtm_A 348 Mutated Mouse P38 Map Kinase Domain In Complex With 4e-08
3hec_A348 P38 In Complex With Imatinib Length = 348 3e-08
3hec_A 348 P38 In Complex With Imatinib Length = 348 4e-08
3oef_X360 Crystal Structure Of Y323f Inactive Mutant Of P38al 3e-08
3oef_X 360 Crystal Structure Of Y323f Inactive Mutant Of P38al 4e-08
3nnu_A354 Crystal Structure Of P38 Alpha In Complex With Dp13 3e-08
3nnu_A 354 Crystal Structure Of P38 Alpha In Complex With Dp13 4e-08
2puu_A348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 3e-08
2puu_A 348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 4e-08
3k3i_A350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 3e-08
3k3i_A 350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 4e-08
3pg1_A362 Map Kinase Lmampk10 From Leishmania Major (1.95 Ang 3e-08
3pg1_A 362 Map Kinase Lmampk10 From Leishmania Major (1.95 Ang 6e-08
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 3e-08
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 3e-08
3uib_A362 Map Kinase Lmampk10 From Leishmania Major In Comple 3e-08
3uib_A 362 Map Kinase Lmampk10 From Leishmania Major In Comple 7e-08
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 3e-08
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 3e-08
4b99_A398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 3e-08
4b99_A 398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 9e-08
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 3e-08
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 3e-08
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 3e-08
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 3e-08
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 3e-08
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 3e-08
4ic7_A442 Crystal Structure Of The Erk5 Kinase Domain In Comp 3e-08
4ic7_A 442 Crystal Structure Of The Erk5 Kinase Domain In Comp 1e-07
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 4e-08
3zgw_A 347 Crystal Structure Of Maternal Embryonic Leucine Zip 4e-08
2b9h_A353 Crystal Structure Of Fus3 With A Docking Motif From 4e-08
2b9h_A 353 Crystal Structure Of Fus3 With A Docking Motif From 8e-08
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 4e-08
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 8e-08
3uys_A296 Crystal Structure Of Apo Human Ck1d Length = 296 4e-08
3uys_A296 Crystal Structure Of Apo Human Ck1d Length = 296 4e-08
1ckj_A317 Casein Kinase I Delta Truncation Mutant Containing 4e-08
1ckj_A 317 Casein Kinase I Delta Truncation Mutant Containing 4e-08
4hni_A296 Crystal Structure Of Ck1e In Complex With Pf4800567 5e-08
4hni_A296 Crystal Structure Of Ck1e In Complex With Pf4800567 5e-08
2vd5_A412 Structure Of Human Myotonic Dystrophy Protein Kinas 5e-08
2vd5_A 412 Structure Of Human Myotonic Dystrophy Protein Kinas 5e-08
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 5e-08
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 5e-08
2nry_A307 Crystal Structure Of Irak-4 Length = 307 5e-08
2nry_A307 Crystal Structure Of Irak-4 Length = 307 5e-08
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 5e-08
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 5e-08
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 5e-08
2f9g_A353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 5e-08
2f9g_A 353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 1e-07
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 5e-08
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 5e-08
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 6e-08
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 6e-08
3gbz_A329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 6e-08
3gbz_A329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 6e-08
4fr4_A384 Crystal Structure Of Human SerineTHREONINE-Protein 6e-08
4fr4_A 384 Crystal Structure Of Human SerineTHREONINE-Protein 6e-08
3mh2_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 6e-08
3mh2_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 9e-08
2b9f_A353 Crystal Structure Of Non-Phosphorylated Fus3 Length 6e-08
2b9f_A 353 Crystal Structure Of Non-Phosphorylated Fus3 Length 1e-07
3b2t_A311 Structure Of Phosphotransferase Length = 311 6e-08
3b2t_A311 Structure Of Phosphotransferase Length = 311 6e-08
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 6e-08
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 6e-08
4exu_A371 Mapk13, Inactive Form Length = 371 7e-08
4exu_A 371 Mapk13, Inactive Form Length = 371 6e-07
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 7e-08
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 7e-08
2nru_A307 Crystal Structure Of Irak-4 Length = 307 7e-08
2nru_A307 Crystal Structure Of Irak-4 Length = 307 7e-08
3coi_A353 Crystal Structure Of P38delta Kinase Length = 353 8e-08
3coi_A 353 Crystal Structure Of P38delta Kinase Length = 353 6e-07
3sv0_A 483 Crystal Structure Of Casein Kinase-1 Like Protein I 8e-08
3sv0_A 483 Crystal Structure Of Casein Kinase-1 Like Protein I 8e-08
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 9e-08
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 9e-08
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 9e-08
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 9e-08
4h58_A275 Braf In Complex With Compound 3 Length = 275 9e-08
4h58_A275 Braf In Complex With Compound 3 Length = 275 9e-08
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 9e-08
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 9e-08
3gp0_A348 Crystal Structure Of Human Mitogen Activated Protei 1e-07
3gp0_A 348 Crystal Structure Of Human Mitogen Activated Protei 4e-07
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-07
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-07
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 1e-07
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 1e-07
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 1e-07
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 1e-07
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 1e-07
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 1e-07
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 1e-07
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 1e-07
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 1e-07
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 1e-07
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 1e-07
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 1e-07
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 1e-07
4aw2_A 437 Crystal Structure Of Cdc42 Binding Protein Kinase A 1e-07
4eut_A396 Structure Of Bx-795 Complexed With Unphosphorylated 1e-07
4eut_A 396 Structure Of Bx-795 Complexed With Unphosphorylated 1e-07
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 1e-07
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 1e-07
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 1e-07
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 1e-07
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 1e-07
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 1e-07
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 2e-07
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 2e-07
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 2e-07
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 2e-07
4g3d_A371 Crystal Structure Of Human Nf-kappab Inducing Kinas 2e-07
4g3d_A371 Crystal Structure Of Human Nf-kappab Inducing Kinas 2e-07
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 2e-07
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 2e-07
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 2e-07
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 2e-07
1y6a_A366 Crystal Structure Of Vegfr2 In Complex With A 2-Ani 2e-07
1y6a_A366 Crystal Structure Of Vegfr2 In Complex With A 2-Ani 2e-07
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 2e-07
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 2e-07
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 2e-07
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 2e-07
3vid_A356 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 2e-07
3vid_A356 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 2e-07
3vhk_A368 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-07
3vhk_A368 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-07
3dls_A335 Crystal Structure Of Human Pas Kinase Bound To Adp 2e-07
3dls_A 335 Crystal Structure Of Human Pas Kinase Bound To Adp 2e-07
3p1a_A311 Structure Of Human Membrane-Associated Tyrosine- An 2e-07
3p1a_A311 Structure Of Human Membrane-Associated Tyrosine- An 2e-07
3vhe_A359 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 2e-07
3vhe_A359 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 2e-07
3ewh_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-07
3ewh_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-07
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 2e-07
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 7e-07
3c7q_A316 Structure Of Vegfr2 Kinase Domain In Complex With B 2e-07
3c7q_A316 Structure Of Vegfr2 Kinase Domain In Complex With B 2e-07
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 2e-07
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 2e-07
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 2e-07
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 3e-07
3u6j_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-07
3u6j_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-07
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-07
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-07
3vnt_A318 Crystal Structure Of The Kinase Domain Of Human Veg 2e-07
3vnt_A318 Crystal Structure Of The Kinase Domain Of Human Veg 2e-07
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 2e-07
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 3e-07
4azf_A417 Human Dyrk2 In Complex With Leucettine L41 Length = 2e-07
4azf_A 417 Human Dyrk2 In Complex With Leucettine L41 Length = 2e-07
3o8p_A360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 2e-07
3o8p_A 360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 3e-07
3ofm_A350 Structure Of A Human Ck2alpha Prime, The Paralog Is 2e-07
3ofm_A 350 Structure Of A Human Ck2alpha Prime, The Paralog Is 2e-07
3e3b_X339 Crystal Structure Of Catalytic Subunit Of Human Pro 2e-07
3e3b_X339 Crystal Structure Of Catalytic Subunit Of Human Pro 2e-07
3mh0_A360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 3e-07
3mh0_A 360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 4e-07
3kvw_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 3e-07
3kvw_A 429 Crystal Structure Of Dual-Specificity Tyrosine Phos 3e-07
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 3e-07
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 3e-07
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 3e-07
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 4e-07
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 3e-07
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 4e-07
3mh3_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 3e-07
3mh3_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 4e-07
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 3e-07
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 4e-07
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 3e-07
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 3e-07
2p2i_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-07
2p2i_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-07
2p2h_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-07
2p2h_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-07
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 3e-07
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 4e-07
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 3e-07
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 4e-07
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 3e-07
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 3e-07
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 3e-07
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 4e-07
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 3e-07
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 4e-07
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 3e-07
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 3e-07
1ywn_A316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 3e-07
1ywn_A316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 3e-07
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 3e-07
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 3e-07
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 3e-07
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 4e-07
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 3e-07
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 4e-07
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-07
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-07
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 3e-07
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 5e-07
3gi3_A360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 3e-07
3gi3_A 360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 4e-07
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 3e-07
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 3e-07
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 3e-07
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 3e-07
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 3e-07
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 4e-07
3nr9_A368 Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length 3e-07
3nr9_A 368 Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length 3e-07
2oh4_A316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 3e-07
2oh4_A316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 3e-07
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 3e-07
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 5e-07
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 3e-07
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 3e-07
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 3e-07
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 5e-07
3mh1_A360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 3e-07
3mh1_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 5e-07
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 3e-07
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 3e-07
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 3e-07
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 3e-07
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 3e-07
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 3e-07
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 3e-07
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 3e-07
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 3e-07
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 3e-07
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-07
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-07
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 3e-07
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 5e-07
2rio_A434 Structure Of The Dual Enzyme Ire1 Reveals The Basis 4e-07
2rio_A 434 Structure Of The Dual Enzyme Ire1 Reveals The Basis 4e-07
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 4e-07
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 4e-07
4euu_A319 Structure Of Bx-795 Complexed With Human Tbk1 Kinas 4e-07
4euu_A319 Structure Of Bx-795 Complexed With Human Tbk1 Kinas 4e-07
3k2l_A429 Crystal Structure Of Dual-Specificity Tyrosine Phos 4e-07
3k2l_A 429 Crystal Structure Of Dual-Specificity Tyrosine Phos 4e-07
3juh_A335 Crystal Structure Of A Mutant Of Human Protein Kina 4e-07
3juh_A335 Crystal Structure Of A Mutant Of Human Protein Kina 4e-07
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 4e-07
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 4e-07
4dn5_A356 Crystal Structure Of Nf-kb-inducing Kinase (nik) Le 4e-07
4dn5_A356 Crystal Structure Of Nf-kb-inducing Kinase (nik) Le 4e-07
3lj0_A434 Ire1 Complexed With Adp And Quercetin Length = 434 4e-07
3lj0_A 434 Ire1 Complexed With Adp And Quercetin Length = 434 4e-07
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 4e-07
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 4e-07
1vr2_A316 Human Vascular Endothelial Growth Factor Receptor 2 4e-07
1vr2_A316 Human Vascular Endothelial Growth Factor Receptor 2 4e-07
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 4e-07
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 7e-07
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 4e-07
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 4e-07
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 5e-07
3a60_A 327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 5e-07
1yhs_A273 Crystal Structure Of Pim-1 Bound To Staurosporine L 5e-07
1yhs_A273 Crystal Structure Of Pim-1 Bound To Staurosporine L 7e-07
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 5e-07
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 5e-07
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 5e-07
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 7e-07
3sdj_A448 Structure Of Rnase-Inactive Point Mutant Of Oligome 5e-07
3sdj_A 448 Structure Of Rnase-Inactive Point Mutant Of Oligome 5e-07
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 5e-07
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 5e-07
3fbv_A448 Crystal Structure Of The Oligomer Formed By The Kin 5e-07
3fbv_A 448 Crystal Structure Of The Oligomer Formed By The Kin 5e-07
2i0v_A335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 5e-07
2i0v_A335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 5e-07
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 5e-07
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 5e-07
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 5e-07
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 5e-07
1pjk_A334 Crystal Structure Of A C-terminal Deletion Mutant O 6e-07
1pjk_A334 Crystal Structure Of A C-terminal Deletion Mutant O 6e-07
3q04_A328 Crystal Structure Of The Apo-Form Of Human Ck2 Alph 6e-07
3q04_A328 Crystal Structure Of The Apo-Form Of Human Ck2 Alph 6e-07
3mb6_A331 Human Ck2 Catalytic Domain In Complex With A Difura 6e-07
3mb6_A331 Human Ck2 Catalytic Domain In Complex With A Difura 6e-07
3kga_A299 Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe 6e-07
3kga_A299 Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe 6e-07
2zjw_A340 Crystal Structure Of Human Ck2 Alpha Complexed With 6e-07
2zjw_A340 Crystal Structure Of Human Ck2 Alpha Complexed With 6e-07
3bqc_A335 High Ph-Value Crystal Structure Of Emodin In Comple 6e-07
3bqc_A335 High Ph-Value Crystal Structure Of Emodin In Comple 6e-07
3u87_A349 Structure Of A Chimeric Construct Of Human Ck2alpha 6e-07
3u87_A 349 Structure Of A Chimeric Construct Of Human Ck2alpha 6e-07
3nga_A333 Human Ck2 Catalytic Domain In Complex With Cx-4945 6e-07
3nga_A333 Human Ck2 Catalytic Domain In Complex With Cx-4945 6e-07
4dtk_A276 Novel And Selective Pan-Pim Kinase Inhibitor Length 6e-07
4dtk_A276 Novel And Selective Pan-Pim Kinase Inhibitor Length 9e-07
3q9w_A336 Crystal Structure Of Human Ck2 Alpha In Complex Wit 6e-07
3q9w_A 336 Crystal Structure Of Human Ck2 Alpha In Complex Wit 6e-07
3nsz_A330 Human Ck2 Catalytic Domain In Complex With Amppn Le 6e-07
3nsz_A330 Human Ck2 Catalytic Domain In Complex With Amppn Le 6e-07
3h30_A334 Crystal Structure Of The Catalytic Subunit Of Human 6e-07
3h30_A334 Crystal Structure Of The Catalytic Subunit Of Human 6e-07
2r7i_A335 Crystal Structure Of Catalytic Subunit Of Protein K 6e-07
2r7i_A335 Crystal Structure Of Catalytic Subunit Of Protein K 6e-07
1jwh_A337 Crystal Structure Of Human Protein Kinase Ck2 Holoe 6e-07
1jwh_A 337 Crystal Structure Of Human Protein Kinase Ck2 Holoe 6e-07
4dgl_C335 Crystal Structure Of The Ck2 Tetrameric Holoenzyme 6e-07
4dgl_C335 Crystal Structure Of The Ck2 Tetrameric Holoenzyme 6e-07
1yxs_A293 Crystal Structure Of Kinase Pim1 With P123m Mutatio 6e-07
1yxs_A293 Crystal Structure Of Kinase Pim1 With P123m Mutatio 1e-06
3hng_A360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 6e-07
3hng_A360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 6e-07
3c4e_A273 Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7 6e-07
3c4e_A273 Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7 9e-07
4as0_A273 Cyclometalated Phthalimides As Protein Kinase Inhib 7e-07
4as0_A273 Cyclometalated Phthalimides As Protein Kinase Inhib 9e-07
3oz6_A388 Crystal Structure Of Mapk From Cryptosporidium Parv 7e-07
3oz6_A 388 Crystal Structure Of Mapk From Cryptosporidium Parv 7e-07
3jxw_A294 Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4- 7e-07
3jxw_A294 Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4- 1e-06
1na7_A329 Crystal Structure Of The Catalytic Subunit Of Human 7e-07
1na7_A329 Crystal Structure Of The Catalytic Subunit Of Human 7e-07
1ywv_A293 Crystal Structures Of Proto-Oncogene Kinase Pim1: A 7e-07
1ywv_A293 Crystal Structures Of Proto-Oncogene Kinase Pim1: A 1e-06
3r00_A299 The Discovery Of Novel Benzofuran-2-Carboxylic Acid 7e-07
3r00_A299 The Discovery Of Novel Benzofuran-2-Carboxylic Acid 1e-06
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 7e-07
3a62_A 327 Crystal Structure Of Phosphorylated P70s6k1 Length 7e-07
4a7c_A308 Crystal Structure Of Pim1 Kinase With Etp46546 Leng 8e-07
4a7c_A308 Crystal Structure Of Pim1 Kinase With Etp46546 Leng 1e-06
3uix_A298 Crystal Structure Of Pim1 Kinase In Complex With Sm 8e-07
3uix_A298 Crystal Structure Of Pim1 Kinase In Complex With Sm 1e-06
2xj0_A301 Protein Kinase Pim-1 In Complex With Fragment-4 Fro 8e-07
2xj0_A301 Protein Kinase Pim-1 In Complex With Fragment-4 Fro 1e-06
2xiy_A301 Protein Kinase Pim-1 In Complex With Fragment-2 Fro 8e-07
2xiy_A301 Protein Kinase Pim-1 In Complex With Fragment-2 Fro 1e-06
3a99_A320 Structure Of Pim-1 Kinase Crystallized In The Prese 8e-07
3a99_A320 Structure Of Pim-1 Kinase Crystallized In The Prese 1e-06
3f2a_A300 Crystal Structure Of Human Pim-1 In Complex With Da 8e-07
3f2a_A300 Crystal Structure Of Human Pim-1 In Complex With Da 1e-06
2xix_A301 Protein Kinase Pim-1 In Complex With Fragment-1 Fro 8e-07
2xix_A301 Protein Kinase Pim-1 In Complex With Fragment-1 Fro 1e-06
4alv_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 8e-07
4alv_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 1e-06
1xqz_A300 Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolut 8e-07
1xqz_A300 Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolut 1e-06
3jpv_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 8e-07
3jpv_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 1e-06
2bil_B313 The Human Protein Kinase Pim1 In Complex With Its C 8e-07
2bil_B313 The Human Protein Kinase Pim1 In Complex With Its C 1e-06
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 8e-07
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 8e-07
3cy3_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 8e-07
3cy3_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 1e-06
1xws_A313 Crystal Structure Of The Human Pim1 Kinase Domain L 8e-07
1xws_A313 Crystal Structure Of The Human Pim1 Kinase Domain L 1e-06
2bik_B313 Human Pim1 Phosphorylated On Ser261 Length = 313 8e-07
2bik_B313 Human Pim1 Phosphorylated On Ser261 Length = 313 1e-06
3ma3_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 8e-07
3ma3_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 1e-06
3cxw_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 8e-07
3cxw_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 1e-06
2j2i_B312 Crystal Structure Of The Humab Pim1 In Complex With 8e-07
2j2i_B312 Crystal Structure Of The Humab Pim1 In Complex With 1e-06
4alu_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 9e-07
4alu_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 1e-06
3fpq_A290 Crystal Structure Of The Kinase Domain Of Wnk1 Leng 9e-07
3fpq_A290 Crystal Structure Of The Kinase Domain Of Wnk1 Leng 9e-07
3dcv_A328 Crystal Structure Of Human Pim1 Kinase Complexed Wi 9e-07
3dcv_A328 Crystal Structure Of Human Pim1 Kinase Complexed Wi 1e-06
2obj_A333 Crystal Structure Of Human Pim-1 Kinase In Complex 9e-07
2obj_A333 Crystal Structure Of Human Pim-1 Kinase In Complex 1e-06
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 9e-07
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 2e-06
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 1e-06
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 2e-06
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 1e-06
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 2e-06
1m2p_A325 Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- Anthra 1e-06
1m2p_A325 Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- Anthra 1e-06
3kxg_A327 Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subun 1e-06
3kxg_A327 Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subun 1e-06
4dgn_A326 Crystal Structure Of Maize Ck2 In Complex With The 1e-06
4dgn_A326 Crystal Structure Of Maize Ck2 In Complex With The 1e-06
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 1e-06
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 1e-06
4anm_A335 Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 1e-06
4anm_A 335 Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 1e-06
1daw_A327 Crystal Structure Of A Binary Complex Of Protein Ki 1e-06
1daw_A327 Crystal Structure Of A Binary Complex Of Protein Ki 1e-06
2qc6_A332 Protein Kinase Ck2 In Complex With Dbc Length = 332 1e-06
2qc6_A 332 Protein Kinase Ck2 In Complex With Dbc Length = 332 1e-06
1ds5_A332 Dimeric Crystal Structure Of The Alpha Subunit In C 1e-06
1ds5_A 332 Dimeric Crystal Structure Of The Alpha Subunit In C 1e-06
4dgm_A326 Crystal Structure Of Maize Ck2 In Complex With The 1e-06
4dgm_A326 Crystal Structure Of Maize Ck2 In Complex With The 1e-06
2pvh_A352 Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]tri 1e-06
2pvh_A 352 Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]tri 1e-06
3pvg_A331 Crystal Structure Of Z. Mays Ck2 Alpha Subunit In C 1e-06
3pvg_A 331 Crystal Structure Of Z. Mays Ck2 Alpha Subunit In C 1e-06
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 1e-06
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 1e-06
2eu9_A355 Crystal Structure Of Clk3 Length = 355 1e-06
2eu9_A 355 Crystal Structure Of Clk3 Length = 355 1e-06
2wu6_A381 Crystal Structure Of The Human Clk3 In Complex With 1e-06
2wu6_A 381 Crystal Structure Of The Human Clk3 In Complex With 1e-06
2exe_A357 Crystal Structure Of The Phosphorylated Clk3 Length 1e-06
2exe_A 357 Crystal Structure Of The Phosphorylated Clk3 Length 1e-06
3p23_A432 Crystal Structure Of The Human Kinase And Rnase Dom 1e-06
3p23_A 432 Crystal Structure Of The Human Kinase And Rnase Dom 4e-06
3ll6_A337 Crystal Structure Of The Human Cyclin G Associated 2e-06
3ll6_A337 Crystal Structure Of The Human Cyclin G Associated 2e-06
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 2e-06
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 2e-06
1q8y_A373 The Structure Of The Yeast Sr Protein Kinase, Sky1p 2e-06
1q8y_A 373 The Structure Of The Yeast Sr Protein Kinase, Sky1p 2e-06
1how_A373 The X-Ray Crystal Structure Of Sky1p, An Sr Protein 2e-06
1how_A 373 The X-Ray Crystal Structure Of Sky1p, An Sr Protein 2e-06
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 2e-06
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 2e-06
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 2e-06
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 2e-06
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 2e-06
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 2e-06
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 2e-06
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 2e-06
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 2e-06
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 2e-06
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 2e-06
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 2e-06
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 2e-06
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 2e-06
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 2e-06
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 2e-06
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 2e-06
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 2e-06
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 2e-06
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 2e-06
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 2e-06
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 2e-06
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 2e-06
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 2e-06
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 2e-06
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 2e-06
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 2e-06
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 2e-06
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 2e-06
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 2e-06
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 2e-06
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 2e-06
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 2e-06
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 2e-06
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 2e-06
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 2e-06
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 2e-06
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 2e-06
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 2e-06
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 2e-06
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 2e-06
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 2e-06
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 2e-06
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 2e-06
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 2e-06
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 2e-06
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 2e-06
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 2e-06
2pl0_A289 Lck Bound To Imatinib Length = 289 2e-06
2pl0_A289 Lck Bound To Imatinib Length = 289 2e-06
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 2e-06
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 2e-06
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 2e-06
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 2e-06
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 2e-06
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 3e-06
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 3e-06
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 3e-06
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 3e-06
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 3e-06
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 3e-06
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 3e-06
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 3e-06
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 3e-06
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 3e-06
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 3e-06
3a4o_X286 Lyn Kinase Domain Length = 286 4e-06
3a4o_X286 Lyn Kinase Domain Length = 286 4e-06
1z57_A339 Crystal Structure Of Human Clk1 In Complex With 10z 4e-06
1z57_A 339 Crystal Structure Of Human Clk1 In Complex With 10z 4e-06
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 4e-06
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 4e-06
3llt_A360 Crystal Structure Of Pf14_0431, Kinase Domain Lengt 4e-06
3llt_A360 Crystal Structure Of Pf14_0431, Kinase Domain Lengt 5e-06
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 4e-06
3n9x_A432 Crystal Structure Of Map Kinase From Plasmodium Ber 4e-06
3n9x_A 432 Crystal Structure Of Map Kinase From Plasmodium Ber 4e-06
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 4e-06
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 4e-06
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 4e-06
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 4e-06
1zxe_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 5e-06
1zxe_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 5e-06
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 5e-06
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 5e-06
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 5e-06
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 5e-06
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 5e-06
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 5e-06
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 5e-06
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 5e-06
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 5e-06
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 5e-06
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 5e-06
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 5e-06
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 5e-06
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 5e-06
3lxn_A318 Structural And Thermodynamic Characterization Of Th 5e-06
3lxn_A318 Structural And Thermodynamic Characterization Of Th 5e-06
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 5e-06
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 5e-06
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 5e-06
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 5e-06
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 5e-06
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 5e-06
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 5e-06
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 5e-06
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 5e-06
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 5e-06
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 5e-06
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 5e-06
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 5e-06
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 5e-06
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 5e-06
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 5e-06
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 5e-06
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 5e-06
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 5e-06
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 5e-06
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 5e-06
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 5e-06
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 5e-06
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 5e-06
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 6e-06
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 6e-06
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 6e-06
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 6e-06
1rjb_A344 Crystal Structure Of Flt3 Length = 344 7e-06
1rjb_A344 Crystal Structure Of Flt3 Length = 344 7e-06
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 7e-06
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 7e-06
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 8e-06
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 8e-06
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 8e-06
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 8e-06
1xkk_A 352 Egfr Kinase Domain Complexed With A Quinazoline Inh 9e-06
2j5f_A 327 Crystal Structure Of Egfr Kinase Domain In Complex 9e-06
3gop_A 361 Crystal Structure Of The Egf Receptor Juxtamembrane 9e-06
3bel_A315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 9e-06
2itn_A 327 Crystal Structure Of Egfr Kinase Domain G719s Mutat 9e-06
4hjo_A 337 Crystal Structure Of The Inactive Egfr Tyrosine Kin 9e-06
2gs7_A 330 Crystal Structure Of The Inactive Egfr Kinase Domai 9e-06
3vjo_A 334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 1e-05
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 1e-05
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 1e-05
2gs2_A 330 Crystal Structure Of The Active Egfr Kinase Domain 1e-05
3rp9_A458 Crystal Structure Of The Apo Mapk From Toxoplasma G 1e-05
3rp9_A 458 Crystal Structure Of The Apo Mapk From Toxoplasma G 1e-05
2eb2_A 334 Crystal Structure Of Mutated Egfr Kinase Domain (G7 1e-05
1m14_A 333 Tyrosine Kinase Domain From Epidermal Growth Factor 1e-05
4g5j_A 330 Crystal Structure Of Egfr Kinase In Complex With Bi 1e-05
4i23_A 329 Crystal Structure Of The Wild-type Egfr Kinase Doma 1e-05
2rfd_A 324 Crystal Structure Of The Complex Between The Egfr K 1e-05
3lzb_A 327 Egfr Kinase Domain Complexed With An Imidazo[2,1-B] 1e-05
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 1e-05
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 1e-05
2cmw_A310 Structure Of Human Casein Kinase 1 Gamma-1 In Compl 1e-05
2cmw_A310 Structure Of Human Casein Kinase 1 Gamma-1 In Compl 1e-05
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 1e-05
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 1e-05
3nie_A429 Crystal Structure Of Pf11_0147 Length = 429 1e-05
3nie_A 429 Crystal Structure Of Pf11_0147 Length = 429 1e-05
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 2e-05
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 2e-05
2iwi_A312 Crystal Structure Of The Human Pim2 In Complex With 2e-05
2iwi_A312 Crystal Structure Of The Human Pim2 In Complex With 2e-05
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 2e-05
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 2e-05
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 2e-05
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 2e-05
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-05
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-05
2buj_A317 Crystal Structure Of The Human Serine-Threonine Kin 2e-05
2buj_A317 Crystal Structure Of The Human Serine-Threonine Kin 2e-05
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 2e-05
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 2e-05
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 2e-05
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 2e-05
1u59_A287 Crystal Structure Of The Zap-70 Kinase Domain In Co 2e-05
1u59_A287 Crystal Structure Of The Zap-70 Kinase Domain In Co 2e-05
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 2e-05
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 2e-05
2csn_A297 Binary Complex Of Casein Kinase-1 With Cki7 Length 2e-05
2csn_A297 Binary Complex Of Casein Kinase-1 With Cki7 Length 2e-05
2jit_A 327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 2e-05
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-05
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-05
1t45_A331 Structural Basis For The Autoinhibition And Sti-571 2e-05
1t45_A331 Structural Basis For The Autoinhibition And Sti-571 2e-05
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 2e-05
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 2e-05
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 2e-05
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 2e-05
3g0f_A336 Kit Kinase Domain Mutant D816h In Complex With Suni 2e-05
3g0f_A336 Kit Kinase Domain Mutant D816h In Complex With Suni 2e-05
2jiu_A 328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 2e-05
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-05
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 2e-05
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 2e-05
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 2e-05
1eh4_A298 Binary Complex Of Casein Kinase-1 From S. Pombe Wit 2e-05
1eh4_A298 Binary Complex Of Casein Kinase-1 From S. Pombe Wit 2e-05
1pkg_A329 Structure Of A C-kit Kinase Product Complex Length 2e-05
1pkg_A329 Structure Of A C-kit Kinase Product Complex Length 2e-05
4g5p_A 330 Crystal Structure Of Egfr Kinase T790m In Complex W 2e-05
3g0e_A336 Kit Kinase Domain In Complex With Sunitinib Length 2e-05
3g0e_A336 Kit Kinase Domain In Complex With Sunitinib Length 2e-05
3ug1_A 334 Crystal Structure Of The Mutated Egfr Kinase Domain 2e-05
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 2e-05
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 2e-05
4i24_A 329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 2e-05
1t46_A313 Structural Basis For The Autoinhibition And Sti-571 2e-05
1t46_A313 Structural Basis For The Autoinhibition And Sti-571 2e-05
3lxk_A327 Structural And Thermodynamic Characterization Of Th 2e-05
3lxk_A327 Structural And Thermodynamic Characterization Of Th 2e-05
2vag_A339 Crystal Structure Of Di-Phosphorylated Human Clk1 I 2e-05
2vag_A 339 Crystal Structure Of Di-Phosphorylated Human Clk1 I 2e-05
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 2e-05
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 2e-05
4i20_A 329 Crystal Structure Of Monomeric (v948r) Primary Onco 2e-05
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 2e-05
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 2e-05
3pjc_A315 Crystal Structure Of Jak3 Complexed With A Potent A 2e-05
3pjc_A315 Crystal Structure Of Jak3 Complexed With A Potent A 2e-05
3ika_A 331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 2e-05
3nz0_A302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 2e-05
3nz0_A302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 2e-05
2eb3_A 334 Crystal Structure Of Mutated Egfr Kinase Domain (L8 3e-05
2itt_A 327 Crystal Structure Of Egfr Kinase Domain L858r Mutat 3e-05
4hgl_A330 Crystal Structure Of Ck1g3 With Compound 1 Length = 3e-05
4hgl_A 330 Crystal Structure Of Ck1g3 With Compound 1 Length = 3e-05
2h34_A309 Apoenzyme Crystal Structure Of The Tuberculosis Ser 3e-05
2h34_A309 Apoenzyme Crystal Structure Of The Tuberculosis Ser 3e-05
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 3e-05
3tl8_A 349 The Avrptob-Bak1 Complex Reveals Two Structurally S 3e-05
3bbt_B 328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 3e-05
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 4e-05
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 4e-05
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 4e-05
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 4e-05
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 4e-05
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 4e-05
2pzi_A 681 Crystal Structure Of Protein Kinase Pkng From Mycob 4e-05
2pzi_A 681 Crystal Structure Of Protein Kinase Pkng From Mycob 4e-05
2r4b_A321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 5e-05
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 5e-05
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 5e-05
2j5e_A327 Crystal Structure Of Egfr Kinase Domain In Complex 5e-05
2j5e_A 327 Crystal Structure Of Egfr Kinase Domain In Complex 5e-05
2jiv_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 5e-05
2jiv_A 328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 5e-05
4i1z_A 329 Crystal Structure Of The Monomeric (v948r) Form Of 6e-05
3w2o_A 331 Egfr Kinase Domain T790m/l858r Mutant With Tak-285 6e-05
4i21_A 329 Crystal Structure Of L858r + T790m Egfr Kinase Doma 6e-05
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 6e-05
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 6e-05
3cik_A 689 Human Grk2 In Complex With Gbetagamma Subunits Leng 7e-05
3cik_A 689 Human Grk2 In Complex With Gbetagamma Subunits Leng 7e-05
3krw_A 688 Human Grk2 In Complex With Gbetgamma Subunits And B 7e-05
3krw_A 688 Human Grk2 In Complex With Gbetgamma Subunits And B 7e-05
4dfl_A274 Crystal Structure Of Spleen Tyrosine Kinase Complex 7e-05
4dfl_A274 Crystal Structure Of Spleen Tyrosine Kinase Complex 7e-05
4f4p_A273 Syk In Complex With Ligand Lasw836 Length = 273 7e-05
4f4p_A273 Syk In Complex With Ligand Lasw836 Length = 273 7e-05
1omw_A 689 Crystal Structure Of The Complex Between G Protein- 7e-05
1omw_A 689 Crystal Structure Of The Complex Between G Protein- 7e-05
3psc_A 695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 7e-05
3psc_A 695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 7e-05
1xba_A291 Crystal Structure Of Apo Syk Tyrosine Kinase Domain 7e-05
1xba_A291 Crystal Structure Of Apo Syk Tyrosine Kinase Domain 7e-05
3tub_A293 Crystal Structure Of Syk Kinase Domain With 1-(5-(6 7e-05
3tub_A293 Crystal Structure Of Syk Kinase Domain With 1-(5-(6 7e-05
3vf8_A299 Crystal Structure Of Spleen Tyrosine Kinase Syk Cat 7e-05
3vf8_A299 Crystal Structure Of Spleen Tyrosine Kinase Syk Cat 7e-05
3srv_B277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 7e-05
3srv_B277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 7e-05
3srv_A277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 8e-05
3srv_A277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 8e-05
3emg_A291 Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylami 8e-05
3emg_A291 Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylami 8e-05
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 9e-05
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 9e-05
3q4t_A322 Crystal Structure Of Activin Receptor Type-Iia (Acv 1e-04
3q4t_A322 Crystal Structure Of Activin Receptor Type-Iia (Acv 1e-04
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 1e-04
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 1e-04
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 1e-04
4fl3_A635 Structural And Biophysical Characterization Of The 1e-04
4fl3_A635 Structural And Biophysical Characterization Of The 1e-04
4fl2_A636 Structural And Biophysical Characterization Of The 1e-04
4fl2_A636 Structural And Biophysical Characterization Of The 1e-04
3uim_A326 Structural Basis For The Impact Of Phosphorylation 1e-04
3uim_A326 Structural Basis For The Impact Of Phosphorylation 1e-04
2chl_A351 Structure Of Casein Kinase 1 Gamma 3 Length = 351 1e-04
2chl_A 351 Structure Of Casein Kinase 1 Gamma 3 Length = 351 1e-04
2izr_A330 Structure Of Casein Kinase Gamma 3 In Complex With 1e-04
2izr_A 330 Structure Of Casein Kinase Gamma 3 In Complex With 1e-04
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 1e-04
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 1e-04
3pp0_A338 Crystal Structure Of The Kinase Domain Of Human Her 1e-04
3pp0_A 338 Crystal Structure Of The Kinase Domain Of Human Her 1e-04
2zm3_A308 Complex Structure Of Insulin-Like Growth Factor Rec 2e-04
2zm3_A308 Complex Structure Of Insulin-Like Growth Factor Rec 2e-04
2ozo_A613 Autoinhibited Intact Human Zap-70 Length = 613 2e-04
2ozo_A613 Autoinhibited Intact Human Zap-70 Length = 613 2e-04
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 2e-04
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 2e-04
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 2e-04
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 2e-04
1k3a_A299 Structure Of The Insulin-Like Growth Factor 1 Recep 2e-04
1k3a_A299 Structure Of The Insulin-Like Growth Factor 1 Recep 3e-04
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 2e-04
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 2e-04
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 3e-04
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 3e-04
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 3e-04
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 3e-04
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 3e-04
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 3e-04
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 3e-04
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 3e-04
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 3e-04
2c47_A313 Structure Of Casein Kinase 1 Gamma 2 Length = 313 3e-04
2c47_A313 Structure Of Casein Kinase 1 Gamma 2 Length = 313 3e-04
1u46_A291 Crystal Structure Of The Unphosphorylated Kinase Do 3e-04
1u54_A291 Crystal Structures Of The Phosphorylated And Unphos 3e-04
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 3e-04
4hzs_A 341 Crystal Structure Of Ack1 Kinase Domain With C-term 3e-04
4hzr_A277 Crystal Structure Of Ack1 Kinase Domain Length = 27 3e-04
4id7_A273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 4e-04
3eqp_B276 Crystal Structure Of Ack1 With Compound T95 Length 4e-04
4ewh_B275 Co-Crystal Structure Of Ack1 With Inhibitor Length 4e-04
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 4e-04
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 4e-04
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 4e-04
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 4e-04
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 4e-04
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 5e-04
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 5e-04
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 5e-04
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 5e-04
1jqh_A308 Igf-1 Receptor Kinase Domain Length = 308 6e-04
1jqh_A308 Igf-1 Receptor Kinase Domain Length = 308 8e-04
3lvp_A336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 6e-04
3lvp_A336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 8e-04
3lw0_A304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 6e-04
3lw0_A304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 8e-04
3o23_A305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 6e-04
3o23_A305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 9e-04
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 6e-04
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 6e-04
3qqu_A301 Cocrystal Structure Of Unphosphorylated Igf With Py 6e-04
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 7e-04
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 7e-04
2oj9_A307 Structure Of Igf-1r Kinase Domain Complexed With A 7e-04
2oj9_A307 Structure Of Igf-1r Kinase Domain Complexed With A 9e-04
3i81_A315 Crystal Structure Of Insulin-Like Growth Factor 1 R 7e-04
1m7n_A322 Crystal Structure Of Unactivated Apo Insulin-Like G 7e-04
1p4o_A322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 7e-04
2qoc_A344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 8e-04
2qoc_A 344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 8e-04
2qob_A344 Human Epha3 Kinase Domain, Base Structure Length = 8e-04
2qob_A 344 Human Epha3 Kinase Domain, Base Structure Length = 8e-04
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure

Iteration: 1

Score = 103 bits (258), Expect = 5e-23, Method: Compositional matrix adjust. Identities = 52/93 (55%), Positives = 68/93 (73%), Gaps = 3/93 (3%) Query: 12 AVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNN-ARSIVGTPSYLSP 70 A+ +H KILHRDIK NI LT K ++L DFGI+++LN+T AR+ +GTP YLSP Sbjct: 137 ALKHVHDRKILHRDIKSQNIFLT--KDGTVQLGDFGIARVLNSTVELARACIGTPYYLSP 194 Query: 71 ELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQA 103 E+C KPY+ +SDIWA+GCVLY + T K AF+A Sbjct: 195 EICENKPYNNKSDIWALGCVLYELCTLKHAFEA 227
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|3RGF|A Chain A, Crystal Structure Of Human Cdk8CYCC Length = 405 Back     alignment and structure
>pdb|3RGF|A Chain A, Crystal Structure Of Human Cdk8CYCC Length = 405 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 Back     alignment and structure
>pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 Back     alignment and structure
>pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 Back     alignment and structure
>pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 Back     alignment and structure
>pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 Back     alignment and structure
>pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 Back     alignment and structure
>pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|2VX3|A Chain A, Crystal Structure Of The Human Dual Specificity Tyrosine- Phosphorylation-Regulated Kinase 1a Length = 382 Back     alignment and structure
>pdb|2VX3|A Chain A, Crystal Structure Of The Human Dual Specificity Tyrosine- Phosphorylation-Regulated Kinase 1a Length = 382 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|3ANQ|A Chain A, Human Dyrk1aINHIBITOR COMPLEX Length = 368 Back     alignment and structure
>pdb|3ANQ|A Chain A, Human Dyrk1aINHIBITOR COMPLEX Length = 368 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|4AZE|A Chain A, Human Dyrk1a In Complex With Leucettine L41 Length = 382 Back     alignment and structure
>pdb|4AZE|A Chain A, Human Dyrk1a In Complex With Leucettine L41 Length = 382 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|4G3C|A Chain A, Crystal Structure Of Apo Murine Nf-kappab Inducing Kinase (nik) Length = 352 Back     alignment and structure
>pdb|4G3C|A Chain A, Crystal Structure Of Apo Murine Nf-kappab Inducing Kinase (nik) Length = 352 Back     alignment and structure
>pdb|4G3F|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) Bound To A 2-(aminothiazoly)phenol (cmp2) Length = 336 Back     alignment and structure
>pdb|4G3F|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) Bound To A 2-(aminothiazoly)phenol (cmp2) Length = 336 Back     alignment and structure
>pdb|4G3G|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) V408l Bound To A 2-(aminothiazolyl)phenol (cmp3) Length = 350 Back     alignment and structure
>pdb|4G3G|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) V408l Bound To A 2-(aminothiazolyl)phenol (cmp3) Length = 350 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|3E3P|A Chain A, Glycogen Synthase Kinase From Leishmania Major Length = 360 Back     alignment and structure
>pdb|3E3P|A Chain A, Glycogen Synthase Kinase From Leishmania Major Length = 360 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|3PG1|A Chain A, Map Kinase Lmampk10 From Leishmania Major (1.95 Angs Resolution) Length = 362 Back     alignment and structure
>pdb|3PG1|A Chain A, Map Kinase Lmampk10 From Leishmania Major (1.95 Angs Resolution) Length = 362 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|3UIB|A Chain A, Map Kinase Lmampk10 From Leishmania Major In Complex With Sb203580 Length = 362 Back     alignment and structure
>pdb|3UIB|A Chain A, Map Kinase Lmampk10 From Leishmania Major In Complex With Sb203580 Length = 362 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|3UYS|A Chain A, Crystal Structure Of Apo Human Ck1d Length = 296 Back     alignment and structure
>pdb|3UYS|A Chain A, Crystal Structure Of Apo Human Ck1d Length = 296 Back     alignment and structure
>pdb|1CKJ|A Chain A, Casein Kinase I Delta Truncation Mutant Containing Residues 1-317 Complex With Bound Tungstate Length = 317 Back     alignment and structure
>pdb|1CKJ|A Chain A, Casein Kinase I Delta Truncation Mutant Containing Residues 1-317 Complex With Bound Tungstate Length = 317 Back     alignment and structure
>pdb|4HNI|A Chain A, Crystal Structure Of Ck1e In Complex With Pf4800567 Length = 296 Back     alignment and structure
>pdb|4HNI|A Chain A, Crystal Structure Of Ck1e In Complex With Pf4800567 Length = 296 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|3SV0|A Chain A, Crystal Structure Of Casein Kinase-1 Like Protein In Plant Length = 483 Back     alignment and structure
>pdb|3SV0|A Chain A, Crystal Structure Of Casein Kinase-1 Like Protein In Plant Length = 483 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|4EUT|A Chain A, Structure Of Bx-795 Complexed With Unphosphorylated Human Tbk1 Kinase- Uld Domain Length = 396 Back     alignment and structure
>pdb|4EUT|A Chain A, Structure Of Bx-795 Complexed With Unphosphorylated Human Tbk1 Kinase- Uld Domain Length = 396 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|4G3D|A Chain A, Crystal Structure Of Human Nf-kappab Inducing Kinase (nik) Length = 371 Back     alignment and structure
>pdb|4G3D|A Chain A, Crystal Structure Of Human Nf-kappab Inducing Kinase (nik) Length = 371 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 Back     alignment and structure
>pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 Back     alignment and structure
>pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 Back     alignment and structure
>pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 Back     alignment and structure
>pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|3P1A|A Chain A, Structure Of Human Membrane-Associated Tyrosine- And Threonine- Specific Cdc2-Inhibitory Kinase Myt1 (Pkmyt1) Length = 311 Back     alignment and structure
>pdb|3P1A|A Chain A, Structure Of Human Membrane-Associated Tyrosine- And Threonine- Specific Cdc2-Inhibitory Kinase Myt1 (Pkmyt1) Length = 311 Back     alignment and structure
>pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 Back     alignment and structure
>pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|3OFM|A Chain A, Structure Of A Human Ck2alpha Prime, The Paralog Isoform Of The Catalytic Subunit Of Protein Kinase Ck2 From Homo Sapiens Length = 350 Back     alignment and structure
>pdb|3OFM|A Chain A, Structure Of A Human Ck2alpha Prime, The Paralog Isoform Of The Catalytic Subunit Of Protein Kinase Ck2 From Homo Sapiens Length = 350 Back     alignment and structure
>pdb|3E3B|X Chain X, Crystal Structure Of Catalytic Subunit Of Human Protein Kinase Ck2alpha Prime With A Potent Indazole-Derivative Inhibitor Length = 339 Back     alignment and structure
>pdb|3E3B|X Chain X, Crystal Structure Of Catalytic Subunit Of Human Protein Kinase Ck2alpha Prime With A Potent Indazole-Derivative Inhibitor Length = 339 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|3NR9|A Chain A, Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length = 368 Back     alignment and structure
>pdb|3NR9|A Chain A, Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length = 368 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|2RIO|A Chain A, Structure Of The Dual Enzyme Ire1 Reveals The Basis For Catalysis And Regulation Of Non-conventional Splicing Length = 434 Back     alignment and structure
>pdb|2RIO|A Chain A, Structure Of The Dual Enzyme Ire1 Reveals The Basis For Catalysis And Regulation Of Non-conventional Splicing Length = 434 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|4EUU|A Chain A, Structure Of Bx-795 Complexed With Human Tbk1 Kinase Domain Phosphorylated On Ser172 Length = 319 Back     alignment and structure
>pdb|4EUU|A Chain A, Structure Of Bx-795 Complexed With Human Tbk1 Kinase Domain Phosphorylated On Ser172 Length = 319 Back     alignment and structure
>pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 Back     alignment and structure
>pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 Back     alignment and structure
>pdb|3JUH|A Chain A, Crystal Structure Of A Mutant Of Human Protein Kinase Ck2alpha With Altered Cosubstrate Specificity Length = 335 Back     alignment and structure
>pdb|3JUH|A Chain A, Crystal Structure Of A Mutant Of Human Protein Kinase Ck2alpha With Altered Cosubstrate Specificity Length = 335 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 Back     alignment and structure
>pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 Back     alignment and structure
>pdb|3LJ0|A Chain A, Ire1 Complexed With Adp And Quercetin Length = 434 Back     alignment and structure
>pdb|3LJ0|A Chain A, Ire1 Complexed With Adp And Quercetin Length = 434 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|1YHS|A Chain A, Crystal Structure Of Pim-1 Bound To Staurosporine Length = 273 Back     alignment and structure
>pdb|1YHS|A Chain A, Crystal Structure Of Pim-1 Bound To Staurosporine Length = 273 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3SDJ|A Chain A, Structure Of Rnase-Inactive Point Mutant Of Oligomeric KinaseRNASE Ire1 Length = 448 Back     alignment and structure
>pdb|3SDJ|A Chain A, Structure Of Rnase-Inactive Point Mutant Of Oligomeric KinaseRNASE Ire1 Length = 448 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|3FBV|A Chain A, Crystal Structure Of The Oligomer Formed By The Kinase-Ribonuclease Domain Of Ire1 Length = 448 Back     alignment and structure
>pdb|3FBV|A Chain A, Crystal Structure Of The Oligomer Formed By The Kinase-Ribonuclease Domain Of Ire1 Length = 448 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|1PJK|A Chain A, Crystal Structure Of A C-terminal Deletion Mutant Of Human Protein Kinase Ck2 Catalytic Subunit Length = 334 Back     alignment and structure
>pdb|1PJK|A Chain A, Crystal Structure Of A C-terminal Deletion Mutant Of Human Protein Kinase Ck2 Catalytic Subunit Length = 334 Back     alignment and structure
>pdb|3Q04|A Chain A, Crystal Structure Of The Apo-Form Of Human Ck2 Alpha At Ph 8.5 Length = 328 Back     alignment and structure
>pdb|3Q04|A Chain A, Crystal Structure Of The Apo-Form Of Human Ck2 Alpha At Ph 8.5 Length = 328 Back     alignment and structure
>pdb|3MB6|A Chain A, Human Ck2 Catalytic Domain In Complex With A Difurane Derivative Inhibitor (Cpa) Length = 331 Back     alignment and structure
>pdb|3MB6|A Chain A, Human Ck2 Catalytic Domain In Complex With A Difurane Derivative Inhibitor (Cpa) Length = 331 Back     alignment and structure
>pdb|3KGA|A Chain A, Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexed With A Potent 3-Aminopyrazole Atp Site Inhibitor Length = 299 Back     alignment and structure
>pdb|3KGA|A Chain A, Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexed With A Potent 3-Aminopyrazole Atp Site Inhibitor Length = 299 Back     alignment and structure
>pdb|2ZJW|A Chain A, Crystal Structure Of Human Ck2 Alpha Complexed With Ellagic Acid Length = 340 Back     alignment and structure
>pdb|2ZJW|A Chain A, Crystal Structure Of Human Ck2 Alpha Complexed With Ellagic Acid Length = 340 Back     alignment and structure
>pdb|3BQC|A Chain A, High Ph-Value Crystal Structure Of Emodin In Complex With The Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|3BQC|A Chain A, High Ph-Value Crystal Structure Of Emodin In Complex With The Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|3U87|A Chain A, Structure Of A Chimeric Construct Of Human Ck2alpha And Human Ck2alpha' In Complex With A Non-hydrolysable Atp-analogue Length = 349 Back     alignment and structure
>pdb|3U87|A Chain A, Structure Of A Chimeric Construct Of Human Ck2alpha And Human Ck2alpha' In Complex With A Non-hydrolysable Atp-analogue Length = 349 Back     alignment and structure
>pdb|3NGA|A Chain A, Human Ck2 Catalytic Domain In Complex With Cx-4945 Length = 333 Back     alignment and structure
>pdb|3NGA|A Chain A, Human Ck2 Catalytic Domain In Complex With Cx-4945 Length = 333 Back     alignment and structure
>pdb|4DTK|A Chain A, Novel And Selective Pan-Pim Kinase Inhibitor Length = 276 Back     alignment and structure
>pdb|4DTK|A Chain A, Novel And Selective Pan-Pim Kinase Inhibitor Length = 276 Back     alignment and structure
>pdb|3Q9W|A Chain A, Crystal Structure Of Human Ck2 Alpha In Complex With Emodin At Ph 8.5 Length = 336 Back     alignment and structure
>pdb|3Q9W|A Chain A, Crystal Structure Of Human Ck2 Alpha In Complex With Emodin At Ph 8.5 Length = 336 Back     alignment and structure
>pdb|3NSZ|A Chain A, Human Ck2 Catalytic Domain In Complex With Amppn Length = 330 Back     alignment and structure
>pdb|3NSZ|A Chain A, Human Ck2 Catalytic Domain In Complex With Amppn Length = 330 Back     alignment and structure
>pdb|3H30|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 With 5,6-Dichloro-1-Beta-D- Ribofuranosylbenzimidazole Length = 334 Back     alignment and structure
>pdb|3H30|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 With 5,6-Dichloro-1-Beta-D- Ribofuranosylbenzimidazole Length = 334 Back     alignment and structure
>pdb|2R7I|A Chain A, Crystal Structure Of Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|2R7I|A Chain A, Crystal Structure Of Catalytic Subunit Of Protein Kinase Ck2 Length = 335 Back     alignment and structure
>pdb|1JWH|A Chain A, Crystal Structure Of Human Protein Kinase Ck2 Holoenzyme Length = 337 Back     alignment and structure
>pdb|1JWH|A Chain A, Crystal Structure Of Human Protein Kinase Ck2 Holoenzyme Length = 337 Back     alignment and structure
>pdb|4DGL|C Chain C, Crystal Structure Of The Ck2 Tetrameric Holoenzyme Length = 335 Back     alignment and structure
>pdb|4DGL|C Chain C, Crystal Structure Of The Ck2 Tetrameric Holoenzyme Length = 335 Back     alignment and structure
>pdb|1YXS|A Chain A, Crystal Structure Of Kinase Pim1 With P123m Mutation Length = 293 Back     alignment and structure
>pdb|1YXS|A Chain A, Crystal Structure Of Kinase Pim1 With P123m Mutation Length = 293 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|3C4E|A Chain A, Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7- Azaindole Length = 273 Back     alignment and structure
>pdb|3C4E|A Chain A, Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7- Azaindole Length = 273 Back     alignment and structure
>pdb|4AS0|A Chain A, Cyclometalated Phthalimides As Protein Kinase Inhibitors Length = 273 Back     alignment and structure
>pdb|4AS0|A Chain A, Cyclometalated Phthalimides As Protein Kinase Inhibitors Length = 273 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|3JXW|A Chain A, Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4-Ones As Potent, Highly Selective And Orally Bioavailable Pim Kinases Inhibitors Length = 294 Back     alignment and structure
>pdb|3JXW|A Chain A, Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4-Ones As Potent, Highly Selective And Orally Bioavailable Pim Kinases Inhibitors Length = 294 Back     alignment and structure
>pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 Back     alignment and structure
>pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 Back     alignment and structure
>pdb|1YWV|A Chain A, Crystal Structures Of Proto-Oncogene Kinase Pim1: A Target Of Aberrant Somatic Hypermutations In Diffuse Large Cell Lymphoma Length = 293 Back     alignment and structure
>pdb|1YWV|A Chain A, Crystal Structures Of Proto-Oncogene Kinase Pim1: A Target Of Aberrant Somatic Hypermutations In Diffuse Large Cell Lymphoma Length = 293 Back     alignment and structure
>pdb|3R00|A Chain A, The Discovery Of Novel Benzofuran-2-Carboxylic Acids As Potent Pim-1 Inhibitors Length = 299 Back     alignment and structure
>pdb|3R00|A Chain A, The Discovery Of Novel Benzofuran-2-Carboxylic Acids As Potent Pim-1 Inhibitors Length = 299 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|4A7C|A Chain A, Crystal Structure Of Pim1 Kinase With Etp46546 Length = 308 Back     alignment and structure
>pdb|4A7C|A Chain A, Crystal Structure Of Pim1 Kinase With Etp46546 Length = 308 Back     alignment and structure
>pdb|3UIX|A Chain A, Crystal Structure Of Pim1 Kinase In Complex With Small Molecule Inhibitor Length = 298 Back     alignment and structure
>pdb|3UIX|A Chain A, Crystal Structure Of Pim1 Kinase In Complex With Small Molecule Inhibitor Length = 298 Back     alignment and structure
>pdb|2XJ0|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-4 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|2XJ0|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-4 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|2XIY|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-2 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|2XIY|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-2 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|3A99|A Chain A, Structure Of Pim-1 Kinase Crystallized In The Presence Of P27kip1 Carboxy-Terminal Peptide Length = 320 Back     alignment and structure
>pdb|3A99|A Chain A, Structure Of Pim-1 Kinase Crystallized In The Presence Of P27kip1 Carboxy-Terminal Peptide Length = 320 Back     alignment and structure
>pdb|3F2A|A Chain A, Crystal Structure Of Human Pim-1 In Complex With Dappa Length = 300 Back     alignment and structure
>pdb|3F2A|A Chain A, Crystal Structure Of Human Pim-1 In Complex With Dappa Length = 300 Back     alignment and structure
>pdb|2XIX|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-1 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|2XIX|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-1 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|4ALV|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|4ALV|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|1XQZ|A Chain A, Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolution Length = 300 Back     alignment and structure
>pdb|1XQZ|A Chain A, Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolution Length = 300 Back     alignment and structure
>pdb|3JPV|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Pyrrolo[2,3- A]carbazole Ligand Length = 313 Back     alignment and structure
>pdb|3JPV|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Pyrrolo[2,3- A]carbazole Ligand Length = 313 Back     alignment and structure
>pdb|2BIL|B Chain B, The Human Protein Kinase Pim1 In Complex With Its Consensus Peptide Pimtide Length = 313 Back     alignment and structure
>pdb|2BIL|B Chain B, The Human Protein Kinase Pim1 In Complex With Its Consensus Peptide Pimtide Length = 313 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|3CY3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And The Jnk Inhibitor V Length = 314 Back     alignment and structure
>pdb|3CY3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And The Jnk Inhibitor V Length = 314 Back     alignment and structure
>pdb|1XWS|A Chain A, Crystal Structure Of The Human Pim1 Kinase Domain Length = 313 Back     alignment and structure
>pdb|1XWS|A Chain A, Crystal Structure Of The Human Pim1 Kinase Domain Length = 313 Back     alignment and structure
>pdb|2BIK|B Chain B, Human Pim1 Phosphorylated On Ser261 Length = 313 Back     alignment and structure
>pdb|2BIK|B Chain B, Human Pim1 Phosphorylated On Ser261 Length = 313 Back     alignment and structure
>pdb|3MA3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Naphtho-Difuran Ligand Length = 313 Back     alignment and structure
>pdb|3MA3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Naphtho-Difuran Ligand Length = 313 Back     alignment and structure
>pdb|3CXW|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Beta Carboline Ligand I Length = 314 Back     alignment and structure
>pdb|3CXW|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Beta Carboline Ligand I Length = 314 Back     alignment and structure
>pdb|2J2I|B Chain B, Crystal Structure Of The Humab Pim1 In Complex With Ly333531 Length = 312 Back     alignment and structure
>pdb|2J2I|B Chain B, Crystal Structure Of The Humab Pim1 In Complex With Ly333531 Length = 312 Back     alignment and structure
>pdb|4ALU|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|4ALU|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 Back     alignment and structure
>pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 Back     alignment and structure
>pdb|3DCV|A Chain A, Crystal Structure Of Human Pim1 Kinase Complexed With 4-(4- Hydroxy-3-Methyl-Phenyl)-6-Phenylpyrimidin-2(1h)-One Length = 328 Back     alignment and structure
>pdb|3DCV|A Chain A, Crystal Structure Of Human Pim1 Kinase Complexed With 4-(4- Hydroxy-3-Methyl-Phenyl)-6-Phenylpyrimidin-2(1h)-One Length = 328 Back     alignment and structure
>pdb|2OBJ|A Chain A, Crystal Structure Of Human Pim-1 Kinase In Complex With Inhibitor Length = 333 Back     alignment and structure
>pdb|2OBJ|A Chain A, Crystal Structure Of Human Pim-1 Kinase In Complex With Inhibitor Length = 333 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|1M2P|A Chain A, Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- AnthraquinoneCK2 KINASE COMPLEX Length = 325 Back     alignment and structure
>pdb|1M2P|A Chain A, Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- AnthraquinoneCK2 KINASE COMPLEX Length = 325 Back     alignment and structure
>pdb|3KXG|A Chain A, Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subunit In Complex With The Inhibitor 3,4,5,6,7-Pentabromo-1h-Indazole (K64) Length = 327 Back     alignment and structure
>pdb|3KXG|A Chain A, Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subunit In Complex With The Inhibitor 3,4,5,6,7-Pentabromo-1h-Indazole (K64) Length = 327 Back     alignment and structure
>pdb|4DGN|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Luteolin Length = 326 Back     alignment and structure
>pdb|4DGN|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Luteolin Length = 326 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|4ANM|A Chain A, Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 Back     alignment and structure
>pdb|4ANM|A Chain A, Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 Back     alignment and structure
>pdb|1DAW|A Chain A, Crystal Structure Of A Binary Complex Of Protein Kinase Ck2 (Alpha-Subunit) And Mg-Amppnp Length = 327 Back     alignment and structure
>pdb|1DAW|A Chain A, Crystal Structure Of A Binary Complex Of Protein Kinase Ck2 (Alpha-Subunit) And Mg-Amppnp Length = 327 Back     alignment and structure
>pdb|2QC6|A Chain A, Protein Kinase Ck2 In Complex With Dbc Length = 332 Back     alignment and structure
>pdb|2QC6|A Chain A, Protein Kinase Ck2 In Complex With Dbc Length = 332 Back     alignment and structure
>pdb|1DS5|A Chain A, Dimeric Crystal Structure Of The Alpha Subunit In Complex With Two Beta Peptides Mimicking The Architecture Of The Tetrameric Protein Kinase Ck2 Holoenzyme. Length = 332 Back     alignment and structure
>pdb|1DS5|A Chain A, Dimeric Crystal Structure Of The Alpha Subunit In Complex With Two Beta Peptides Mimicking The Architecture Of The Tetrameric Protein Kinase Ck2 Holoenzyme. Length = 332 Back     alignment and structure
>pdb|4DGM|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Apigenin Length = 326 Back     alignment and structure
>pdb|4DGM|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Apigenin Length = 326 Back     alignment and structure
>pdb|2PVH|A Chain A, Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]triazine Derivatives As Potent Inhibitors Of Protein Kinase Ck2 Length = 352 Back     alignment and structure
>pdb|2PVH|A Chain A, Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]triazine Derivatives As Potent Inhibitors Of Protein Kinase Ck2 Length = 352 Back     alignment and structure
>pdb|3PVG|A Chain A, Crystal Structure Of Z. Mays Ck2 Alpha Subunit In Complex With The Inhibitor 4,5,6,7-Tetrabromo-1-Carboxymethylbenzimidazole (K68) Length = 331 Back     alignment and structure
>pdb|3PVG|A Chain A, Crystal Structure Of Z. Mays Ck2 Alpha Subunit In Complex With The Inhibitor 4,5,6,7-Tetrabromo-1-Carboxymethylbenzimidazole (K68) Length = 331 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|2EU9|A Chain A, Crystal Structure Of Clk3 Length = 355 Back     alignment and structure
>pdb|2EU9|A Chain A, Crystal Structure Of Clk3 Length = 355 Back     alignment and structure
>pdb|2WU6|A Chain A, Crystal Structure Of The Human Clk3 In Complex With Dki Length = 381 Back     alignment and structure
>pdb|2WU6|A Chain A, Crystal Structure Of The Human Clk3 In Complex With Dki Length = 381 Back     alignment and structure
>pdb|2EXE|A Chain A, Crystal Structure Of The Phosphorylated Clk3 Length = 357 Back     alignment and structure
>pdb|2EXE|A Chain A, Crystal Structure Of The Phosphorylated Clk3 Length = 357 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|1Q8Y|A Chain A, The Structure Of The Yeast Sr Protein Kinase, Sky1p, With Bound Adp Length = 373 Back     alignment and structure
>pdb|1Q8Y|A Chain A, The Structure Of The Yeast Sr Protein Kinase, Sky1p, With Bound Adp Length = 373 Back     alignment and structure
>pdb|1HOW|A Chain A, The X-Ray Crystal Structure Of Sky1p, An Sr Protein Kinase In Yeast Length = 373 Back     alignment and structure
>pdb|1HOW|A Chain A, The X-Ray Crystal Structure Of Sky1p, An Sr Protein Kinase In Yeast Length = 373 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 Back     alignment and structure
>pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|3LLT|A Chain A, Crystal Structure Of Pf14_0431, Kinase Domain Length = 360 Back     alignment and structure
>pdb|3LLT|A Chain A, Crystal Structure Of Pf14_0431, Kinase Domain Length = 360 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 Back     alignment and structure
>pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 Back     alignment and structure
>pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 Back     alignment and structure
>pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 Back     alignment and structure
>pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|2CMW|A Chain A, Structure Of Human Casein Kinase 1 Gamma-1 In Complex With 2-(2-Hydroxyethylamino)-6-(3-Chloroanilino)-9- Isopropylpurine (Casp Target) Length = 310 Back     alignment and structure
>pdb|2CMW|A Chain A, Structure Of Human Casein Kinase 1 Gamma-1 In Complex With 2-(2-Hydroxyethylamino)-6-(3-Chloroanilino)-9- Isopropylpurine (Casp Target) Length = 310 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 Back     alignment and structure
>pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 Back     alignment and structure
>pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|2BUJ|A Chain A, Crystal Structure Of The Human Serine-Threonine Kinase 16 In Complex With Staurosporine Length = 317 Back     alignment and structure
>pdb|2BUJ|A Chain A, Crystal Structure Of The Human Serine-Threonine Kinase 16 In Complex With Staurosporine Length = 317 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 Back     alignment and structure
>pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|2CSN|A Chain A, Binary Complex Of Casein Kinase-1 With Cki7 Length = 297 Back     alignment and structure
>pdb|2CSN|A Chain A, Binary Complex Of Casein Kinase-1 With Cki7 Length = 297 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|1EH4|A Chain A, Binary Complex Of Casein Kinase-1 From S. Pombe With An Atp Competitive Inhibitor, Ic261 Length = 298 Back     alignment and structure
>pdb|1EH4|A Chain A, Binary Complex Of Casein Kinase-1 From S. Pombe With An Atp Competitive Inhibitor, Ic261 Length = 298 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|2VAG|A Chain A, Crystal Structure Of Di-Phosphorylated Human Clk1 In Complex With A Novel Substituted Indole Inhibitor Length = 339 Back     alignment and structure
>pdb|2VAG|A Chain A, Crystal Structure Of Di-Phosphorylated Human Clk1 In Complex With A Novel Substituted Indole Inhibitor Length = 339 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 Back     alignment and structure
>pdb|4HGL|A Chain A, Crystal Structure Of Ck1g3 With Compound 1 Length = 330 Back     alignment and structure
>pdb|4HGL|A Chain A, Crystal Structure Of Ck1g3 With Compound 1 Length = 330 Back     alignment and structure
>pdb|2H34|A Chain A, Apoenzyme Crystal Structure Of The Tuberculosis SerineTHREONINE Kinase, Pkne Length = 309 Back     alignment and structure
>pdb|2H34|A Chain A, Apoenzyme Crystal Structure Of The Tuberculosis SerineTHREONINE Kinase, Pkne Length = 309 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|2PZI|A Chain A, Crystal Structure Of Protein Kinase Pkng From Mycobacterium Tuberculosis In Complex With Tetrahydrobenzothiophene Ax20017 Length = 681 Back     alignment and structure
>pdb|2PZI|A Chain A, Crystal Structure Of Protein Kinase Pkng From Mycobacterium Tuberculosis In Complex With Tetrahydrobenzothiophene Ax20017 Length = 681 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 Back     alignment and structure
>pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 Back     alignment and structure
>pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|4DFL|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Complexed With A Sulfonamidopyrazine Piperidine Inhibitor Length = 274 Back     alignment and structure
>pdb|4DFL|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Complexed With A Sulfonamidopyrazine Piperidine Inhibitor Length = 274 Back     alignment and structure
>pdb|4F4P|A Chain A, Syk In Complex With Ligand Lasw836 Length = 273 Back     alignment and structure
>pdb|4F4P|A Chain A, Syk In Complex With Ligand Lasw836 Length = 273 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|1XBA|A Chain A, Crystal Structure Of Apo Syk Tyrosine Kinase Domain Length = 291 Back     alignment and structure
>pdb|1XBA|A Chain A, Crystal Structure Of Apo Syk Tyrosine Kinase Domain Length = 291 Back     alignment and structure
>pdb|3TUB|A Chain A, Crystal Structure Of Syk Kinase Domain With 1-(5-(6,7- Dimethoxyquinolin-4-Yloxy)pyridin-2-Yl)-3-((1r,2s)-2- Phenylcyclopropyl)urea Length = 293 Back     alignment and structure
>pdb|3TUB|A Chain A, Crystal Structure Of Syk Kinase Domain With 1-(5-(6,7- Dimethoxyquinolin-4-Yloxy)pyridin-2-Yl)-3-((1r,2s)-2- Phenylcyclopropyl)urea Length = 293 Back     alignment and structure
>pdb|3VF8|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Syk Catalytic Domain With Pyrazolylbenzimidazole Inhibitor 416 Length = 299 Back     alignment and structure
>pdb|3VF8|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Syk Catalytic Domain With Pyrazolylbenzimidazole Inhibitor 416 Length = 299 Back     alignment and structure
>pdb|3SRV|B Chain B, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|3SRV|B Chain B, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|3SRV|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|3SRV|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|3EMG|A Chain A, Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylaminopyrimidines As Potent Inhibitors Of Spleen Tyrosine Kinase (Syk) Length = 291 Back     alignment and structure
>pdb|3EMG|A Chain A, Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylaminopyrimidines As Potent Inhibitors Of Spleen Tyrosine Kinase (Syk) Length = 291 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|3Q4T|A Chain A, Crystal Structure Of Activin Receptor Type-Iia (Acvr2a) Kinase Domain In Complex With Dorsomorphin Length = 322 Back     alignment and structure
>pdb|3Q4T|A Chain A, Crystal Structure Of Activin Receptor Type-Iia (Acvr2a) Kinase Domain In Complex With Dorsomorphin Length = 322 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 Back     alignment and structure
>pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 Back     alignment and structure
>pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 Back     alignment and structure
>pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|2CHL|A Chain A, Structure Of Casein Kinase 1 Gamma 3 Length = 351 Back     alignment and structure
>pdb|2CHL|A Chain A, Structure Of Casein Kinase 1 Gamma 3 Length = 351 Back     alignment and structure
>pdb|2IZR|A Chain A, Structure Of Casein Kinase Gamma 3 In Complex With Inhibitor Length = 330 Back     alignment and structure
>pdb|2IZR|A Chain A, Structure Of Casein Kinase Gamma 3 In Complex With Inhibitor Length = 330 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|3PP0|A Chain A, Crystal Structure Of The Kinase Domain Of Human Her2 (Erbb2). Length = 338 Back     alignment and structure
>pdb|3PP0|A Chain A, Crystal Structure Of The Kinase Domain Of Human Her2 (Erbb2). Length = 338 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 Back     alignment and structure
>pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|2C47|A Chain A, Structure Of Casein Kinase 1 Gamma 2 Length = 313 Back     alignment and structure
>pdb|2C47|A Chain A, Structure Of Casein Kinase 1 Gamma 2 Length = 313 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query233
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 2e-46
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 3e-46
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 2e-45
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 3e-45
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 2e-44
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 3e-44
2a19_B284 Interferon-induced, double-stranded RNA-activated 9e-43
2a19_B284 Interferon-induced, double-stranded RNA-activated 9e-43
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 7e-37
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 1e-36
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 5e-36
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 5e-36
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 3e-33
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 4e-33
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 6e-32
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 4e-31
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 2e-31
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 2e-31
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 9e-30
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 9e-30
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 2e-29
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 2e-29
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 2e-29
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 2e-29
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 2e-29
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 8e-29
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 3e-29
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 4e-29
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 3e-29
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 3e-29
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 5e-29
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 7e-29
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 1e-28
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 1e-28
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 4e-28
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 1e-27
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 6e-28
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 2e-27
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 7e-28
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 7e-28
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 7e-28
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 7e-28
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 8e-28
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 8e-28
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 9e-28
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 9e-28
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-27
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-27
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 2e-27
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 2e-27
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 2e-27
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 2e-27
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 3e-27
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 3e-27
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 3e-27
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 5e-27
3bhy_A283 Death-associated protein kinase 3; death associate 4e-27
3bhy_A283 Death-associated protein kinase 3; death associate 4e-27
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 7e-27
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 7e-27
3ork_A311 Serine/threonine protein kinase; structural genomi 7e-27
3ork_A311 Serine/threonine protein kinase; structural genomi 2e-26
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 7e-27
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 7e-27
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 8e-27
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 8e-27
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 9e-27
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 2e-26
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 1e-26
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 1e-26
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 1e-26
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 1e-26
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 1e-26
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 2e-26
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 1e-26
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 1e-26
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-26
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 2e-26
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 2e-26
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 2e-26
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 2e-26
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 2e-26
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 3e-26
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 4e-26
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 3e-26
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 3e-26
2y0a_A326 Death-associated protein kinase 1; transferase, ca 3e-26
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 3e-26
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 3e-26
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 3e-26
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 4e-26
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 4e-26
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 4e-26
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 4e-26
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 4e-26
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 5e-26
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 5e-26
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 5e-26
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 8e-26
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 8e-26
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 9e-26
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 9e-26
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 1e-25
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 1e-25
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 2e-25
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 2e-25
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 2e-25
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 2e-25
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 2e-25
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 2e-25
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 2e-25
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 2e-25
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-25
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-25
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 3e-25
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 3e-25
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 3e-25
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 4e-25
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 4e-25
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 4e-25
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 1e-24
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 1e-24
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 1e-24
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 1e-24
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 1e-24
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 2e-24
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-24
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-24
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 1e-24
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 1e-24
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 2e-24
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 2e-24
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 2e-24
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 2e-24
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 3e-24
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 3e-24
3dls_A335 PAS domain-containing serine/threonine-protein KI; 3e-24
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 3e-24
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 4e-24
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 4e-24
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 4e-24
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 4e-24
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 7e-24
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 7e-24
3eqc_A360 Dual specificity mitogen-activated protein kinase; 1e-23
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 1e-23
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 2e-23
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 2e-23
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 3e-23
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 3e-23
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 1e-22
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 1e-22
2eue_A275 Carbon catabolite derepressing protein kinase; kin 1e-22
2eue_A275 Carbon catabolite derepressing protein kinase; kin 1e-22
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 2e-22
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 2e-22
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 3e-22
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 3e-22
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 3e-22
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 3e-22
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 3e-22
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 2e-21
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 6e-22
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 6e-22
3aln_A327 Dual specificity mitogen-activated protein kinase; 7e-22
3aln_A327 Dual specificity mitogen-activated protein kinase; 7e-22
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 7e-22
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 7e-22
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 1e-21
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 1e-21
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 1e-21
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 3e-21
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 1e-21
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 1e-21
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 2e-21
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 2e-21
3an0_A340 Dual specificity mitogen-activated protein kinase; 2e-21
3an0_A340 Dual specificity mitogen-activated protein kinase; 2e-21
2dyl_A318 Dual specificity mitogen-activated protein kinase 2e-21
2dyl_A318 Dual specificity mitogen-activated protein kinase 2e-21
3fme_A290 Dual specificity mitogen-activated protein kinase; 3e-21
3fme_A290 Dual specificity mitogen-activated protein kinase; 3e-21
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 3e-21
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 3e-21
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 4e-21
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 4e-21
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 5e-21
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 5e-21
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 5e-21
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 5e-21
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 7e-21
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 1e-20
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 8e-21
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 8e-21
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 9e-21
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 3e-20
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 9e-21
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 9e-21
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 1e-20
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 1e-20
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 1e-20
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 1e-20
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-20
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-20
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 1e-20
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 1e-20
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 1e-20
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 1e-20
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-20
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-20
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 2e-20
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 2e-20
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 2e-20
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 2e-20
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 2e-20
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 2e-20
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 3e-20
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 3e-20
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 3e-20
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 3e-20
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 4e-20
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 4e-20
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 4e-20
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 4e-20
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 5e-20
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 5e-20
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 6e-20
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 6e-20
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 6e-20
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 6e-20
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 8e-20
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 8e-20
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 9e-20
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 9e-20
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 1e-19
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 1e-19
3niz_A311 Rhodanese family protein; structural genomics, str 1e-19
3niz_A311 Rhodanese family protein; structural genomics, str 1e-19
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-19
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-19
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 1e-19
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 1e-19
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 2e-19
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 2e-19
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 2e-19
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 2e-19
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 2e-19
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 2e-19
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 2e-19
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 6e-19
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 2e-19
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 2e-19
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 2e-19
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 2e-19
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 3e-19
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 4e-19
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 3e-19
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 3e-19
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 3e-19
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 3e-19
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 7e-19
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 7e-18
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 8e-19
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 2e-18
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 9e-19
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 9e-19
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 1e-18
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 4e-18
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 1e-18
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 8e-18
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-18
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-18
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 1e-18
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 1e-18
3o0g_A292 Cell division protein kinase 5; kinase activator c 2e-18
3o0g_A292 Cell division protein kinase 5; kinase activator c 2e-18
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 2e-18
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 2e-18
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 2e-18
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 2e-18
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 3e-18
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 7e-18
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 3e-18
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 3e-18
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 3e-18
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-17
2fst_X367 Mitogen-activated protein kinase 14; active mutant 4e-18
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 1e-17
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 6e-18
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 6e-18
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 7e-18
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 7e-18
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 7e-18
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 8e-18
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 7e-18
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 2e-17
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 2e-17
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 2e-17
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 2e-17
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 2e-17
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 5e-17
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 1e-16
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 7e-17
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 7e-17
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 1e-16
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 1e-16
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 2e-16
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 2e-16
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 6e-16
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 6e-16
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 9e-16
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 9e-16
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 1e-15
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 3e-15
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 2e-15
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 2e-15
3soc_A322 Activin receptor type-2A; structural genomics cons 3e-15
3soc_A322 Activin receptor type-2A; structural genomics cons 5e-15
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 6e-15
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 6e-15
3rp9_A458 Mitogen-activated protein kinase; structural genom 1e-14
3rp9_A 458 Mitogen-activated protein kinase; structural genom 1e-14
3q4u_A301 Activin receptor type-1; structural genomics conso 2e-14
3q4u_A301 Activin receptor type-1; structural genomics conso 4e-14
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 2e-14
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 2e-14
3uqc_A286 Probable conserved transmembrane protein; structur 2e-14
3uqc_A286 Probable conserved transmembrane protein; structur 9e-14
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 3e-14
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 5e-14
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 4e-14
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 4e-14
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 4e-14
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 4e-14
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 6e-14
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 6e-14
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 2e-13
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 2e-13
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 2e-13
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 2e-13
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 1e-12
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 1e-12
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 2e-12
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 2e-12
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 6e-12
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 6e-12
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 1e-11
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 1e-11
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 2e-11
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 2e-10
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 4e-11
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 4e-11
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 9e-11
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 1e-10
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 1e-10
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 1e-10
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 2e-10
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 2e-10
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-10
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 3e-10
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 3e-10
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 3e-10
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 4e-10
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 4e-10
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 3e-09
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 7e-08
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 3e-09
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 3e-09
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 3e-09
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 6e-07
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 3e-09
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 2e-07
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 5e-09
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 2e-07
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 7e-09
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 3e-07
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 7e-09
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 4e-07
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 1e-08
3lzb_A327 Epidermal growth factor receptor; epidermal growth 4e-07
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 1e-08
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 4e-08
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 1e-08
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 2e-06
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 2e-08
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 3e-08
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 2e-08
3poz_A327 Epidermal growth factor receptor; kinase domain, a 9e-07
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-08
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-08
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 5e-08
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 7e-06
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 5e-08
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 1e-05
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 6e-08
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 3e-06
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 7e-08
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 4e-07
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 7e-08
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 9e-06
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 9e-08
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 1e-06
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-07
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 7e-06
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 1e-07
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 1e-07
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 1e-07
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 1e-05
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 1e-07
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 1e-07
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 2e-07
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 2e-07
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 2e-07
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 1e-05
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 3e-07
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 5e-07
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 3e-07
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 4e-06
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 3e-07
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 3e-06
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 3e-07
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 1e-05
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 3e-07
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 3e-07
2xir_A316 Vascular endothelial growth factor receptor 2; ang 3e-07
2xir_A316 Vascular endothelial growth factor receptor 2; ang 3e-07
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 3e-07
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 5e-06
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 4e-07
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 3e-05
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 4e-07
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 4e-06
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 4e-07
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 8e-07
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 4e-07
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 4e-07
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 5e-07
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 5e-07
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 7e-07
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 7e-07
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 7e-07
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 7e-07
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 8e-07
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 3e-05
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 9e-07
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 3e-06
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 1e-06
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 4e-06
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 1e-06
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 3e-06
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 2e-06
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 3e-06
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 2e-06
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 9e-06
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-06
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 8e-06
3pls_A298 Macrophage-stimulating protein receptor; protein k 3e-06
3pls_A298 Macrophage-stimulating protein receptor; protein k 2e-05
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 3e-06
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 2e-05
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 3e-06
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 2e-05
4aoj_A329 High affinity nerve growth factor receptor; transf 3e-06
4aoj_A329 High affinity nerve growth factor receptor; transf 3e-06
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 4e-06
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 4e-06
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 9e-06
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 5e-05
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 3e-04
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 3e-04
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
 Score =  156 bits (397), Expect = 2e-46
 Identities = 57/115 (49%), Positives = 78/115 (67%), Gaps = 3/115 (2%)

Query: 1   ELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNN-AR 59
           ++L  F Q+ LA+  +H  KILHRDIK  NI LT  K   ++L DFGI+++LN+T   AR
Sbjct: 126 QILDWFVQICLALKHVHDRKILHRDIKSQNIFLT--KDGTVQLGDFGIARVLNSTVELAR 183

Query: 60  SIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQASVYLIVCVLIR 114
           + +GTP YLSPE+C  KPY+ +SDIWA+GCVLY + T K AF+A     + + I 
Sbjct: 184 ACIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKNLVLKII 238


>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query233
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.97
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.97
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.97
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.97
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.97
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.97
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.97
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.97
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.97
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.97
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.96
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.96
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.96
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.96
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.96
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.96
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.96
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.96
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.96
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.96
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.96
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.96
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.96
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.96
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.96
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.96
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.96
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.96
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.96
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.96
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.96
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.96
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.96
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.96
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.96
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.96
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.96
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.96
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.96
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.96
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.96
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.95
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.95
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.95
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.95
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.95
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.95
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.95
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.95
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.95
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.95
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.95
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.95
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.95
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.95
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.95
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.95
3niz_A311 Rhodanese family protein; structural genomics, str 99.95
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.95
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.95
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.95
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.95
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.95
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.95
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.95
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.95
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.95
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.95
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.95
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.95
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.95
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.95
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.95
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.95
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.95
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.95
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.95
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.95
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.95
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.95
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.95
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.95
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.95
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.95
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.95
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.94
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.94
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.94
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.94
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.94
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.94
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.94
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.94
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.94
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.94
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.94
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.94
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.94
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.94
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.94
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.94
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.94
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.94
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.94
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.94
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.94
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.94
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.94
4aoj_A329 High affinity nerve growth factor receptor; transf 99.94
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.94
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.94
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.94
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.94
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.94
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.94
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.94
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.94
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.94
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.94
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.94
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.94
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.94
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.94
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.94
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.94
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.94
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.94
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.94
3ork_A311 Serine/threonine protein kinase; structural genomi 99.94
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.94
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.94
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.94
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.94
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.94
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.94
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.94
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.94
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.94
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.94
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.94
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.94
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.94
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.94
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.94
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.93
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.93
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.93
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.93
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.93
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.93
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.93
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.93
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.93
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.93
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.93
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.93
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.93
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.93
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.93
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.93
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.93
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.93
3bhy_A283 Death-associated protein kinase 3; death associate 99.93
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.93
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.93
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.93
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.93
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.93
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.93
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.93
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.93
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.93
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.93
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.93
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.93
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.93
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.93
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.93
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.93
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.93
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.93
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.93
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.93
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.93
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.93
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.93
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.93
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.93
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.93
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.93
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.93
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.93
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.93
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.93
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.93
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.93
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.93
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.93
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.93
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.93
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.93
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.93
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.93
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.93
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.93
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.92
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.92
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.92
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.92
3q4u_A301 Activin receptor type-1; structural genomics conso 99.92
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.92
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.92
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.92
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.92
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.92
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.92
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.92
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.92
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.92
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.92
3soc_A322 Activin receptor type-2A; structural genomics cons 99.92
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.92
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.92
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.92
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.92
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.92
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.92
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.92
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.92
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.92
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.92
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.92
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.92
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.92
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.92
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.92
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.92
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.91
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.91
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.91
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.91
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.91
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.91
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.91
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.9
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.9
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.9
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.9
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.9
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.9
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.9
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.9
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.9
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.9
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.9
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.9
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.9
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.9
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.9
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.89
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.89
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.89
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.89
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.89
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.89
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.89
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.89
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.89
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.89
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.89
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.89
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.89
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.89
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.89
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.89
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.89
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.89
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.89
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.88
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.88
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.88
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.88
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.88
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.88
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.88
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.88
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.88
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.88
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.88
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.88
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.88
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.88
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.88
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.88
3niz_A311 Rhodanese family protein; structural genomics, str 99.87
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.87
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.87
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.87
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 99.87
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.87
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.87
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.87
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.87
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.87
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.87
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.87
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.87
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.87
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.87
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.87
3ork_A311 Serine/threonine protein kinase; structural genomi 99.87
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.87
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.87
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.87
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.87
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.87
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.87
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.87
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.87
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.87
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.87
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.87
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.86
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.86
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.86
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.86
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.86
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.86
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.86
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.86
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.86
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.86
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.86
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.86
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.86
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.86
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.86
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.86
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 99.86
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.86
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.86
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 99.86
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.86
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.86
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.86
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.86
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.86
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.86
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.86
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.86
3soc_A322 Activin receptor type-2A; structural genomics cons 99.86
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.86
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.86
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.86
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.86
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.85
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.85
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.85
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.85
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.85
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.85
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.85
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.85
3q4u_A301 Activin receptor type-1; structural genomics conso 99.85
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.85
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.85
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.85
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.85
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.85
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.85
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.85
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.85
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.85
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.84
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.84
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.84
3bhy_A283 Death-associated protein kinase 3; death associate 99.84
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.84
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.84
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.84
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.84
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.84
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.84
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.84
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.84
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.84
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.84
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.84
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.84
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.84
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.84
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.84
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.84
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.84
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.84
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.84
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.84
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.84
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.84
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.84
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.84
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.84
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.84
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.84
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.84
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.83
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.83
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.83
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.83
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.83
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.83
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.83
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.83
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.83
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.83
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.83
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.83
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.83
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.83
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 99.83
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.83
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.83
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.83
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.83
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.83
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.83
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.83
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.83
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.83
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.82
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.82
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.82
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.82
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.82
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.82
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.82
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.82
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.82
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.82
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.82
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.82
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.82
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.82
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.82
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.82
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.82
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.82
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.82
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.82
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.82
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.82
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.82
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.82
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.82
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.82
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.82
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.82
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.81
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.81
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.81
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.81
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.81
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.81
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.81
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.81
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.81
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.81
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.81
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.81
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.8
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.8
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.8
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.8
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.8
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.8
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.8
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.79
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.79
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.78
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.78
3uqc_A286 Probable conserved transmembrane protein; structur 99.77
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.73
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
Probab=100.00  E-value=9.6e-40  Score=265.23  Aligned_cols=144  Identities=31%  Similarity=0.540  Sum_probs=124.6

Q ss_pred             CHHHHHHHHHHHHHHHHhCCCeecCCCCCCeEEecCCCCcEEEEeeeceeeecCC---CCccccccCCccccccccCCCC
Q psy18200          1 ELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTT---NNARSIVGTPSYLSPELCLGKP   77 (233)
Q Consensus         1 ~~~~~~~qi~~~l~~lH~~~iihrdik~~nil~~~~~~~~~kl~dfg~~~~~~~~---~~~~~~~gt~~y~ape~~~~~~   77 (233)
                      ++.+|+.||+.||+|||++||+||||||+|||++.+  +.+||+|||+|+.+...   ....+.+||+.|||||++.+++
T Consensus       133 ~~~~~~~qi~~al~ylH~~~IiHRDlKPeNILl~~~--g~vKl~DFGla~~~~~~~~~~~~~~~~GTp~YmAPEvl~~~~  210 (311)
T 4aw0_A          133 CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNED--MHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKS  210 (311)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTEECSCCSGGGEEECTT--SCEEECCCTTCEECCTTTTCCCBCCCCSCGGGCCHHHHHHSC
T ss_pred             HHHHHHHHHHHHHHHHHHCCCccCCCCHHHeEEcCC--CCEEEEEcCCceecCCCCCcccccCcccCcccCCHHHHcCCC
Confidence            367899999999999999999999999999999655  88999999999977532   2345789999999999999999


Q ss_pred             CCccchHHHHHHHHHHHhhccccchhhHHHHHHHHHHhhccCCCCCCchhHHHHHHHHHHHHHHhhh--cccCC
Q psy18200         78 YSIQSDIWAMGCVLYFMTTHKIAFQASVYLIVCVLIRYQVDLRDGPDQVYLRELLFLFSQLLLAVHF--IHASK  149 (233)
Q Consensus        78 ~~~~~diwslg~~~~~~~~~~~pf~~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~~~~~q~l~~~~~--~~~~~  149 (233)
                      |+.++|+||+||++|+|++|++||.+.+...+...+.. ... .+++. .++++++++.++|..++.  +.+.+
T Consensus       211 y~~~~DiWSlGvilyeml~G~~PF~~~~~~~~~~~i~~-~~~-~~p~~-~s~~~~dli~~lL~~dp~~R~t~~e  281 (311)
T 4aw0_A          211 ACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIK-LEY-DFPEK-FFPKARDLVEKLLVLDATKRLGCEE  281 (311)
T ss_dssp             BCHHHHHHHHHHHHHHHHHSSCSSCCSSHHHHHHHHHH-TCC-CCCTT-CCHHHHHHHHHHSCSSGGGSTTSGG
T ss_pred             CCcHHHHHHHHHHHHHHHhCCCCCCCCCHHHHHHHHHc-CCC-CCCcc-cCHHHHHHHHHHccCCHhHCcChHH
Confidence            99999999999999999999999999888888888876 433 45555 788999999999988876  54444



>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 233
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-29
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-29
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-29
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 4e-29
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 3e-29
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 3e-28
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 5e-29
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 1e-27
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-27
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-27
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-27
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-26
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-27
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 4e-27
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-26
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 5e-26
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 5e-26
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 6e-26
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 5e-26
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 6e-26
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 7e-26
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-25
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 1e-25
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 3e-24
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-25
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-25
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 5e-25
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 7e-25
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-24
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-24
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 3e-24
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 4e-24
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 6e-24
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 1e-23
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 4e-23
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 4e-23
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 5e-23
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-22
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 7e-23
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 2e-22
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 9e-23
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-22
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-22
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-22
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 5e-22
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 7e-22
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 7e-22
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 9e-22
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 8e-22
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-21
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 2e-21
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 2e-21
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 2e-21
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 4e-21
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 3e-21
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 4e-20
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 4e-21
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-20
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 5e-21
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 3e-20
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 8e-21
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 1e-20
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 8e-21
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-20
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 9e-21
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-20
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 1e-20
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-20
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 1e-20
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 3e-20
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-20
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 3e-20
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 2e-20
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 3e-20
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 2e-20
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 3e-20
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-20
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 3e-20
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 3e-20
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-19
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 3e-20
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 9e-20
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-19
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 3e-19
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 2e-19
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 4e-19
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 2e-19
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 3e-19
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 3e-19
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 4e-19
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 4e-19
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 5e-19
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 4e-19
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 7e-19
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-18
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 5e-18
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 6e-18
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 6e-18
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 8e-18
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 1e-17
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 8e-18
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-17
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 2e-17
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 3e-17
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-17
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 3e-17
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 7e-17
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-16
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 7e-17
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 2e-16
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 1e-16
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-16
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-16
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 3e-16
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 3e-16
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 4e-16
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 5e-16
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 2e-15
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 7e-16
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 6e-15
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-15
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 3e-15
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-14
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-14
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 2e-09
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 2e-09
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Aurora-related kinase 1 (aurora-2)
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  109 bits (273), Expect = 1e-29
 Identities = 32/105 (30%), Positives = 59/105 (56%), Gaps = 3/105 (2%)

Query: 129 RELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNAR 188
           +      ++L  A+ + H+ +++HRDIKP N+LL  +    LK++DFG S    ++    
Sbjct: 106 QRTATYITELANALSYCHSKRVIHRDIKPENLLLGSA--GELKIADFGWSVHAPSSR-RT 162

Query: 189 SIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQAS 233
           ++ GT  YL PE+  G+ +  + D+W++G + Y     K  F+A+
Sbjct: 163 TLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN 207


>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query233
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.98
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.98
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.98
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.98
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.98
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.98
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.97
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.97
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.97
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.97
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.97
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.97
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.97
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.97
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.97
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.97
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.97
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.97
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.97
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.97
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.97
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.97
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.97
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.97
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.97
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.97
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.96
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.96
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.96
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.96
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.96
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.96
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.96
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.96
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.95
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.95
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.95
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.95
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.95
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.95
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.95
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.95
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.95
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.95
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.95
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.94
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.94
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.94
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.94
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.94
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.94
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.94
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.94
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.94
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.94
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.94
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.94
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.93
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.93
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.93
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.93
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.93
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.93
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.93
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.93
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.92
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.92
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.92
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.92
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.92
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.92
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.92
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.92
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.92
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.92
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.92
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.92
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.91
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.91
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.91
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.91
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.91
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.91
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.91
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.9
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.9
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.9
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.9
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.9
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.9
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.9
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.9
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.89
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.89
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.88
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.88
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.88
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.87
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.87
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.87
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.86
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.85
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.56
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 98.97
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 93.11
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 90.25
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 89.91
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 85.1
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 83.84
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 81.92
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 81.11
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Aurora-related kinase 1 (aurora-2)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.1e-37  Score=245.40  Aligned_cols=149  Identities=30%  Similarity=0.431  Sum_probs=125.2

Q ss_pred             HHHHHHHHHHHHHHHHhCCCeecCCCCCCeEEecCCCCcEEEEeeeceeeecCCCCccccccCCccccccccCCCCCCcc
Q psy18200          2 LLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQ   81 (233)
Q Consensus         2 ~~~~~~qi~~~l~~lH~~~iihrdik~~nil~~~~~~~~~kl~dfg~~~~~~~~~~~~~~~gt~~y~ape~~~~~~~~~~   81 (233)
                      +..++.||+.||+|||++||+||||||+|||++.+  +.+|++|||+++..... ......||+.|+|||++.+++|+.+
T Consensus       108 ~~~i~~qi~~al~~lH~~~ivHrDiKp~Nill~~~--~~~kl~DFG~a~~~~~~-~~~~~~Gt~~Y~APE~~~~~~~~~~  184 (263)
T d2j4za1         108 TATYITELANALSYCHSKRVIHRDIKPENLLLGSA--GELKIADFGWSVHAPSS-RRTTLCGTLDYLPPEMIEGRMHDEK  184 (263)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCCCCCCGGGEEECTT--SCEEECCCCSCSCCCCC-CCEETTEEGGGCCHHHHTTCCCCTT
T ss_pred             HHHHHHHHHHHHHHHHHCCeeeeeeccccceecCC--CCEeecccceeeecCCC-cccccCCCCcccCHHHHcCCCCCch
Confidence            67899999999999999999999999999999655  78999999999765443 3455689999999999999999999


Q ss_pred             chHHHHHHHHHHHhhccccchhhHHHHHHHHHHhhccCCCCCCchhHHHHHHHHHHHHHHhhh--cccCCcc-ccCCC
Q psy18200         82 SDIWAMGCVLYFMTTHKIAFQASVYLIVCVLIRYQVDLRDGPDQVYLRELLFLFSQLLLAVHF--IHASKIL-HRDIK  156 (233)
Q Consensus        82 ~diwslg~~~~~~~~~~~pf~~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~~~~~q~l~~~~~--~~~~~i~-h~dlk  156 (233)
                      +|+||+||++|+|++|+.||.+.+...+...+.. ... .+++. .++++.+++.++|..++.  +.+.+++ |++++
T Consensus       185 ~DiwSlGvilyell~G~~Pf~~~~~~~~~~~i~~-~~~-~~p~~-~s~~~~~li~~~L~~dp~~R~t~~eil~hp~~~  259 (263)
T d2j4za1         185 VDLWSLGVLCYEFLVGKPPFEANTYQETYKRISR-VEF-TFPDF-VTEGARDLISRLLKHNPSQRPMLREVLEHPWIT  259 (263)
T ss_dssp             HHHHHHHHHHHHHHHSSCTTCCSSHHHHHHHHHT-TCC-CCCTT-SCHHHHHHHHHHTCSSGGGSCCHHHHHTCHHHH
T ss_pred             hhhhhHhHHHHHHhcCCCCCCCCCHHHHHHHHHc-CCC-CCCcc-CCHHHHHHHHHHccCCHhHCcCHHHHHcCcCcC
Confidence            9999999999999999999998888877777765 332 34444 677999999999988776  6666666 66553



>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure