Diaphorina citri psyllid: psy18200

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---

ELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQASVYLIVCVLIRYQVDLRDGPDQVYLRELLFLFSQLLLAVHFIHASKILHRDIKPCNILLTGSKGNLLKLSDFGISKLLNTTNNARSIVGTPSYLSPELCLGKPYSIQSDIWAMGCVLYFMTTHKIAFQAS

cHHHHHHHHHHHHHHHHcccccccccccccEEECcccccEEEEcccccHHcccccccccccccccccccHHHcccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEccccccCEEEccccHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine/threonine-protein kinase Nek8	Required for renal tubular integrity. May regulate local cytoskeletal structure in kidney tubule epithelial cells. May regulate ciliary biogenesis through targeting of proteins to the cilia.	confident	Q91ZR4
Serine/threonine-protein kinase Nek8	Required for renal tubular integrity. May regulate local cytoskeletal structure in kidney tubule epithelial cells. May regulate ciliary biogenesis through targeting of proteins to the cilia.	confident	Q86SG6
Serine/threonine-protein kinase Nek3	May be involved in plant development processes.	confident	Q8RX66

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0035556 [BP]	intracellular signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0004672 [MF]	protein kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674
GO:0019901 [MF]	protein kinase binding	probable	GO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UTO, chain A
Confidence level:very confident
Coverage over the Query: 2-159
View the alignment between query and template
View the model in PyMOL

Template: 2W5A, chain A
Confidence level:very confident
Coverage over the Query: 128-232
View the alignment between query and template
View the model in PyMOL