Diaphorina citri psyllid: psy18202

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------

PEFPDTECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSLLEHLNRYSKEFILCRMKLLDQFLRRVTSHPVLSVNSHAIIFLTAKLAEFSMHKKHSPGLLNKMSESFYNLTNIYTTMSLRHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNTWAGYEPQLSSVIRQVSKAVDTTASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARRDVIQAEHDMCGEELQKKTAEKEQLTNKDSDSSSPTSSTATSSTNSYSLWKSTSEDRLEKLSTAIPKLTSQLEICDEKLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYYQQRSDRGNCNC

ccccccccCEEEEcccHHHHHHHHHHHcccEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHccccHHHHHHHcccccccccHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc

***PDTECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSLLEHLNRYSKEFILCRMKLLDQFLRRVTSHPVLSVNSHAIIFLTAKLAEFSMHKKHSPGLLNKMSESFYNLTNIYTTMSLRHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNTWAGYEPQLSSVIRQVSKAVDTTASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARRDVIQAEHDMCGEELQK***************************************************TSQLEICDEKLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYYQQRSDRGNCNC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Sorting nexin-30	May be involved in several stages of intracellular trafficking.	confident	Q28E02
Sorting nexin-30	May be involved in several stages of intracellular trafficking.	confident	Q566W7
Sorting nexin-30	May be involved in several stages of intracellular trafficking.	confident	Q8CE50

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005769 [CC]	early endosome	probable	GO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DYT, chain A
Confidence level:very confident
Coverage over the Query: 6-37,53-242,254-263,284-285,300-355
View the alignment between query and template
View the model in PyMOL

Template: 1URU, chain A
Confidence level:confident
Coverage over the Query: 123-263,290-355
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3i2w, chain A		probable	Alignment \| Template Structure