Psyllid ID: psy18202


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------
PEFPDTECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSLLEHLNRYSKEFILCRMKLLDQFLRRVTSHPVLSVNSHAIIFLTAKLAEFSMHKKHSPGLLNKMSESFYNLTNIYTTMSLRHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNTWAGYEPQLSSVIRQVSKAVDTTASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARRDVIQAEHDMCGEELQKKTAEKEQLTNKDSDSSSPTSSTATSSTNSYSLWKSTSEDRLEKLSTAIPKLTSQLEICDEKLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYYQQRSDRGNCNC
ccccccccEEEEEcccHHHHHHHHHHHcccEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHccccHHHHHHHccccccccHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
cccccccccEEEcHHHHHHHHHHHHHHccEEEcccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccEccccHHEEEEcccHHHHHHHHHccccHHHccccHccccHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
pefpdtecivrRRYNDFVWLHNKLvetlpshiipplpekhsLLEHLNRYSKEFILCRMKLLDQFLRrvtshpvlsvnsHAIIFLTAKLAEfsmhkkhspgllnkMSESFYNLTNIYTTMSLRHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNTwagyepqlSSVIRQVSKAVDTTASLHKNlliepfhehnshpmkDYLMYIDAVKQVLARRDVIQAEHDMCGEELQKKTAEKeqltnkdsdsssptsstatsstnsyslwkSTSEDRLEKLSTAIPKLTSQLEICDEKLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYYQqrsdrgncnc
pefpdtecivrrRYNDFVWLHNKLVEtlpshiippLPEKHSLLEHLNRYSKEFILCRMKLLDQFLRRVTshpvlsvnsHAIIFLTAKLAEFSMHKKHSPGLLNKMSESFYNLTNIYTTMSLRHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNTWAGYEPQLSSVIRQVSKAVDTTASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARRDVIQAEHDMcgeelqkktaekeqltnkdsdsssptsstatsstnsyslWKSTSEDRLEKLSTAIPKLTSQLEICDEKLQTANNhlrsdlerwrlEKKNDLKKILLKIADQQIAyyqqrsdrgncnc
PEFPDTECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSLLEHLNRYSKEFILCRMKLLDQFLRRVTSHPVLSVNSHAIIFLTAKLAEFSMHKKHSPGLLNKMSESFYNLTNIYTTMSLRHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNTWAGYEPQLSSVIRQVSKAVDTTASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARRDVIQAEHDMCGEELQKKTAEKEQLTNKDsdsssptsstatsstnsysLWKSTSEDRLEKLSTAIPKLTSQLEICDEKLQTANNHLRSDLERWRlekkndlkkillkIADQQIAYYQQRSDRGNCNC
******ECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSLLEHLNRYSKEFILCRMKLLDQFLRRVTSHPVLSVNSHAIIFLTAKLAEFSMHKKHSPGLLNKMSESFYNLTNIYTTMSLRHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNTWAGYEPQLSSVIRQVSKAVDTTASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARRDVIQAEH**************************************************************QLEICDEKLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYY***********
***PDTECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSL****NRYSKEFILCRMKLLDQFLRRVTSHPVLSVNSHAIIFLTAKLAEFS******************NLTNIYTTMSLRHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNTWAGYEPQLSSVIRQVSKAVDTTASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARRDVIQAEHDMCGEELQK***************************************************TSQLEICDEKLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYYQQRSDRGNCNC
PEFPDTECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSLLEHLNRYSKEFILCRMKLLDQFLRRVTSHPVLSVNSHAIIFLTAKLAEFSMHKKHSPGLLNKMSESFYNLTNIYTTMSLRHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNTWAGYEPQLSSVIRQVSKAVDTTASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARRDVIQAEHDMCGEEL*****************************************RLEKLSTAIPKLTSQLEICDEKLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYYQ**********
**F*DTECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSLLEHLNRYSKEFILCRMKLLDQFLRRVTSHPVLSVNSHAIIFLTAKLAEFSMHKKHSPGLLNKMSESFYNLTNIYTTMSLRHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNTWAGYEPQLSSVIRQVSKAVDTTASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARRDVIQAEHDMCGEELQKKTAEKEQLTNKDSDSSSPTSSTATSSTNSYSLWKSTSEDRLEKLSTAIPKLTSQLEICDEKLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYYQQRSDRGNCNC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PEFPDTECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSLLEHLNRYSKEFILCRMKLLDQFLRRVTSHPVLSVNSHAIIFLTAKLAEFSMHKKHSPGLLNKMSESFYNLTNIYTTMSLRHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNTWAGYEPQLSSVIRQVSKAVDTTASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARRDVIQAEHDMCGEELQKKTAEKEQLTNKDSDSSSPTSSTATSSTNSYSLWKSTSEDRLEKLSTAIPKLTSQLEICDEKLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYYQQRSDRGNCNC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query357 2.2.26 [Sep-21-2011]
Q4V7P7452 Sorting nexin-30 OS=Xenop N/A N/A 0.834 0.659 0.334 5e-50
Q5VWJ9437 Sorting nexin-30 OS=Homo yes N/A 0.834 0.681 0.325 4e-49
Q8CE50437 Sorting nexin-30 OS=Mus m yes N/A 0.834 0.681 0.317 4e-49
Q28E02446 Sorting nexin-30 OS=Xenop yes N/A 0.834 0.668 0.331 9e-47
Q566W7430 Sorting nexin-30 OS=Danio yes N/A 0.829 0.688 0.308 2e-44
Q9CY18387 Sorting nexin-7 OS=Mus mu no N/A 0.823 0.759 0.313 6e-44
Q4R5U9387 Sorting nexin-7 OS=Macaca N/A N/A 0.843 0.777 0.308 4e-43
Q9UNH6387 Sorting nexin-7 OS=Homo s no N/A 0.843 0.777 0.308 2e-42
Q5B797487 Sorting nexin-4 OS=Emeric yes N/A 0.932 0.683 0.245 2e-18
Q6FPT9430 Sorting nexin-4 OS=Candid yes N/A 0.938 0.779 0.238 5e-18
>sp|Q4V7P7|SNX30_XENLA Sorting nexin-30 OS=Xenopus laevis GN=snx30 PE=2 SV=1 Back     alignment and function desciption
 Score =  198 bits (504), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 183/347 (52%), Gaps = 49/347 (14%)

Query: 2   EFPDTECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSLLEHLNRYSKEFILCRMKLL 61
           EF   E  VRRRY DF WL NKL ET P+H IPPLPEK  +   ++R+S+EF+  R K L
Sbjct: 136 EFDLPEYSVRRRYQDFDWLRNKLEETQPTHFIPPLPEKFVVKGVVDRFSEEFVETRRKAL 195

Query: 62  DQFLRRVTSHPVLSVNSHAIIFLTAKLAEFSMHKKHSPGLLNKMSESFYNLTNIYTTMSL 121
           D+FL+R+  HPVLS N H  +FLTAK  + + HKK    LL+KM ES   +T+ Y    L
Sbjct: 196 DKFLKRIADHPVLSFNEHFNVFLTAK--DLNSHKKQGVTLLSKMGESVRYVTSGY---KL 250

Query: 122 RHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNTWAGYEPQLS 181
           R+  +EF   + Y+     K+   ++I  R+ KE  +Y+ E  ++  V +TW+G E +L+
Sbjct: 251 RNRPAEFATVTDYLDTFALKLGTIDRIAQRIIKEEVEYLMELREYGPVYSTWSGLEKELN 310

Query: 182 SVIRQVSKAVDTTASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARRDVIQAEHDMC 241
             +  VS  V    +  +  L E   E     +++Y++Y +++K VL +RD +QAE++  
Sbjct: 311 EPLEGVSACVGNCCTALEE-LTEDMSEDFMPVIREYILYSESMKTVLKKRDQVQAEYEAK 369

Query: 242 GEELQKKTAEKEQLTNKDSDSSSPTSSTATSSTNSYSLWKSTSEDRLEKLSTAIPKLTSQ 301
            E    K  E+         S+ PT                                   
Sbjct: 370 SEAAALKREER---------STVPTD---------------------------------- 386

Query: 302 LEICDEKLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYYQQ 348
           +E C +K++  N  L++D++RW+  K+ D +++L+ +AD+ I YY++
Sbjct: 387 VEKCQDKVECFNADLKADMDRWQNNKRQDFRQLLMGVADKNIQYYEK 433




May be involved in several stages of intracellular trafficking.
Xenopus laevis (taxid: 8355)
>sp|Q5VWJ9|SNX30_HUMAN Sorting nexin-30 OS=Homo sapiens GN=SNX30 PE=1 SV=1 Back     alignment and function description
>sp|Q8CE50|SNX30_MOUSE Sorting nexin-30 OS=Mus musculus GN=Snx30 PE=2 SV=1 Back     alignment and function description
>sp|Q28E02|SNX30_XENTR Sorting nexin-30 OS=Xenopus tropicalis GN=snx30 PE=2 SV=1 Back     alignment and function description
>sp|Q566W7|SNX30_DANRE Sorting nexin-30 OS=Danio rerio GN=snx30 PE=2 SV=1 Back     alignment and function description
>sp|Q9CY18|SNX7_MOUSE Sorting nexin-7 OS=Mus musculus GN=Snx7 PE=2 SV=1 Back     alignment and function description
>sp|Q4R5U9|SNX7_MACFA Sorting nexin-7 OS=Macaca fascicularis GN=SNX7 PE=2 SV=1 Back     alignment and function description
>sp|Q9UNH6|SNX7_HUMAN Sorting nexin-7 OS=Homo sapiens GN=SNX7 PE=1 SV=1 Back     alignment and function description
>sp|Q5B797|SNX4_EMENI Sorting nexin-4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=snx4 PE=3 SV=1 Back     alignment and function description
>sp|Q6FPT9|SNX4_CANGA Sorting nexin-4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SNX4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query357
156554601 471 PREDICTED: sorting nexin-30-like [Nasoni 0.927 0.702 0.455 8e-84
307176960 476 Sorting nexin-30 [Camponotus floridanus] 0.932 0.699 0.464 1e-83
350424617 475 PREDICTED: sorting nexin-30-like [Bombus 0.932 0.701 0.455 1e-83
340726740 475 PREDICTED: sorting nexin-30-like [Bombus 0.932 0.701 0.458 2e-83
307200847 475 Sorting nexin-30 [Harpegnathos saltator] 0.932 0.701 0.458 2e-82
383851305 475 PREDICTED: sorting nexin-30-like [Megach 0.932 0.701 0.452 4e-82
328784676 468 PREDICTED: sorting nexin-30-like [Apis m 0.929 0.709 0.456 8e-82
380020486 478 PREDICTED: sorting nexin-30-like [Apis f 0.929 0.694 0.462 9e-82
332016777 477 Sorting nexin-30 [Acromyrmex echinatior] 0.929 0.696 0.448 1e-80
91090194393 PREDICTED: similar to sorting nexin fami 0.929 0.844 0.402 1e-67
>gi|156554601|ref|XP_001604661.1| PREDICTED: sorting nexin-30-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  317 bits (811), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 159/349 (45%), Positives = 233/349 (66%), Gaps = 18/349 (5%)

Query: 1   PEFPDTECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSLLEHLNRYSKEFILCRMKL 60
           PE+ + E IVRRRYNDF+WL  KLVE+ P+HIIPP+P KHSLL  L+RYSKEFI+ RMKL
Sbjct: 108 PEYEEGEYIVRRRYNDFIWLRQKLVESYPAHIIPPMPGKHSLLAQLDRYSKEFIIARMKL 167

Query: 61  LDQFLRRVTSHPVLSVNSHAIIFLTAKLAEFSMHKKHSPGLLNKMSESFYNLTNIYTTMS 120
           L  FL R+ +HP+LS + +  +FLTAK AEF +++K+   ++ K+S+S   L ++ +   
Sbjct: 168 LHIFLNRMVNHPILSYDKNLHVFLTAKPAEFLVYRKNRGNVMGKVSDS---LQSMASNGV 224

Query: 121 LRHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNTWAGYEPQL 180
           ++  H EFEQ   Y  +L EK+S  +KI  R++KER+DY+ E HQ   +   WA  EPQL
Sbjct: 225 VKQRHLEFEQARDYCVSLSEKLSTIDKISRRIHKERQDYLVELHQLHPIFTLWATSEPQL 284

Query: 181 SSVIRQVSKAVDTTASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARRDVIQAEHDM 240
           +  ++ V+ A+++ AS H+ LL    +E      ++Y+ YIDAVK  L+RRD +Q E++M
Sbjct: 285 ARTLQAVAGAIESNASAHQKLLDTAVNEE-----REYITYIDAVKDALSRRDTMQVEYEM 339

Query: 241 CGEELQKKTAEKEQLTNKDSDSSSPTSSTATSSTNSYSLWKSTSE-DRLEKLSTAIPKLT 299
             EEL K+  E++Q+          +S   TSS    S WK+ S  ++L++LS  IP+L+
Sbjct: 340 TAEELTKRKTERDQII---------SSGNITSSRWDNSFWKTESNGEKLDRLSQTIPRLS 390

Query: 300 SQLEICDEKLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYYQQ 348
             +E+  ++L+ AN +LRSDLERW +EK+ DLK IL+ +ADQQI +YQQ
Sbjct: 391 KVVEVLQDRLECANENLRSDLERWNIEKRTDLKNILIAMADQQIGHYQQ 439




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307176960|gb|EFN66266.1| Sorting nexin-30 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350424617|ref|XP_003493855.1| PREDICTED: sorting nexin-30-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340726740|ref|XP_003401711.1| PREDICTED: sorting nexin-30-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307200847|gb|EFN80900.1| Sorting nexin-30 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383851305|ref|XP_003701174.1| PREDICTED: sorting nexin-30-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328784676|ref|XP_392678.3| PREDICTED: sorting nexin-30-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380020486|ref|XP_003694114.1| PREDICTED: sorting nexin-30-like [Apis florea] Back     alignment and taxonomy information
>gi|332016777|gb|EGI57598.1| Sorting nexin-30 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|91090194|ref|XP_967096.1| PREDICTED: similar to sorting nexin family member 30 [Tribolium castaneum] gi|270013469|gb|EFA09917.1| hypothetical protein TcasGA2_TC012068 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query357
UNIPROTKB|F1ND98385 SNX30 "Uncharacterized protein 0.694 0.644 0.366 2.3e-48
UNIPROTKB|E1BMD8389 SNX30 "Uncharacterized protein 0.694 0.637 0.362 2.9e-48
UNIPROTKB|F1SNA5393 SNX30 "Uncharacterized protein 0.694 0.631 0.358 6e-48
MGI|MGI:2443882437 Snx30 "sorting nexin family me 0.694 0.567 0.362 7.7e-48
UNIPROTKB|F1Q3P2351 SNX30 "Uncharacterized protein 0.649 0.660 0.378 1.2e-47
UNIPROTKB|F2Z4F6451 SNX7 "Uncharacterized protein" 0.711 0.563 0.354 3.3e-47
UNIPROTKB|Q5VWJ9437 SNX30 "Sorting nexin-30" [Homo 0.649 0.530 0.378 5.3e-47
RGD|1305480387 Snx7 "sorting nexin 7" [Rattus 0.711 0.656 0.334 1.1e-44
UNIPROTKB|F1S551387 LOC100515025 "Uncharacterized 0.711 0.656 0.342 1.1e-44
UNIPROTKB|E2RSU1390 SNX7 "Uncharacterized protein" 0.711 0.651 0.338 7.6e-44
UNIPROTKB|F1ND98 SNX30 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 434 (157.8 bits), Expect = 2.3e-48, Sum P(2) = 2.3e-48
 Identities = 93/254 (36%), Positives = 147/254 (57%)

Query:     2 EFPDTECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSLLEHLNRYSKEFILCRMKLL 61
             EF   E  VRRRY DF WL NKL E+ P+H+IPPLPEK  +   ++R+S+EF+  R K L
Sbjct:    69 EFDLPEYSVRRRYQDFDWLRNKLEESQPTHLIPPLPEKFVVKGVVDRFSEEFVETRRKAL 128

Query:    62 DQFLRRVTSHPVLSVNSHAIIFLTAKLAEFSMHKKHSPGLLNKMSESFYNLTNIYTTMSL 121
             D+FL+R+T HPVLS N H  +FLTAK  + + +KK    LL+KM ES   +T  Y    L
Sbjct:   129 DKFLKRITDHPVLSFNEHFNVFLTAK--DLNAYKKQGMALLSKMGESVKYVTGGY---KL 183

Query:   122 RHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNTWAGYEPQLS 181
             R    EF    +Y+     K+   ++I  R+ KE+ +Y+ E  ++  + +TW G E +LS
Sbjct:   184 RSRPLEFAAIGEYLDTFSLKLGTIDRIAQRIIKEQLEYLVELREYGPIYSTWGGLEVELS 243

Query:   182 SVIRQVSKAVDTTASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARRDVIQAEHDMC 241
               +  VS  +    +  + L  E   +     +++Y++Y +++K VL +RD +QAE++  
Sbjct:   244 EPLEGVSACIGNCCTALEELS-EDMTDDFLPVLREYILYSESMKNVLKKRDQVQAEYEAK 302

Query:   242 GEELQKKTAEKEQL 255
              E +  K  ++ ++
Sbjct:   303 LEAVALKKEDRPKV 316


GO:0005737 "cytoplasm" evidence=IEA
GO:0007154 "cell communication" evidence=IEA
GO:0035091 "phosphatidylinositol binding" evidence=IEA
UNIPROTKB|E1BMD8 SNX30 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SNA5 SNX30 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2443882 Snx30 "sorting nexin family member 30" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3P2 SNX30 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4F6 SNX7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5VWJ9 SNX30 "Sorting nexin-30" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1305480 Snx7 "sorting nexin 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S551 LOC100515025 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSU1 SNX7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8CE50SNX30_MOUSENo assigned EC number0.31700.83470.6819yesN/A
Q5VWJ9SNX30_HUMANNo assigned EC number0.32560.83470.6819yesN/A
Q28E02SNX30_XENTRNo assigned EC number0.33140.83470.6681yesN/A
Q6CTQ0SNX4_KLULANo assigned EC number0.25070.89910.8025yesN/A
Q566W7SNX30_DANRENo assigned EC number0.30830.82910.6883yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
cd07624200 cd07624, BAR_SNX7_30, The Bin/Amphiphysin/Rvs (BAR 5e-41
cd06860116 cd06860, PX_SNX7_30_like, The phosphoinositide bin 9e-38
cd07667240 cd07667, BAR_SNX30, The Bin/Amphiphysin/Rvs (BAR) 4e-32
cd07666243 cd07666, BAR_SNX7, The Bin/Amphiphysin/Rvs (BAR) d 8e-30
cd07283116 cd07283, PX_SNX30, The phosphoinositide binding Ph 9e-25
cd06863118 cd06863, PX_Atg24p, The phosphoinositide binding P 3e-24
cd06859114 cd06859, PX_SNX1_2_like, The phosphoinositide bind 1e-20
cd07284116 cd07284, PX_SNX7, The phosphoinositide binding Pho 3e-20
cd07596218 cd07596, BAR_SNX, The Bin/Amphiphysin/Rvs (BAR) do 5e-20
COG5391524 COG5391, COG5391, Phox homology (PX) domain protei 8e-20
pfam00787109 pfam00787, PX, PX domain 2e-15
cd06093106 cd06093, PX_domain, The Phox Homology domain, a ph 3e-15
cd06864129 cd06864, PX_SNX4, The phosphoinositide binding Pho 5e-15
cd06862125 cd06862, PX_SNX9_18_like, The phosphoinositide bin 1e-14
cd06861112 cd06861, PX_Vps5p, The phosphoinositide binding Ph 2e-14
smart00312105 smart00312, PX, PhoX homologous domain, present in 1e-13
cd06867112 cd06867, PX_SNX41_42, The phosphoinositide binding 5e-13
cd06865120 cd06865, PX_SNX_like, The phosphoinositide binding 7e-13
cd06866105 cd06866, PX_SNX8_Mvp1p_like, The phosphoinositide 1e-12
cd06894123 cd06894, PX_SNX3_like, The phosphoinositide bindin 2e-10
cd06898113 cd06898, PX_SNX10, The phosphoinositide binding Ph 1e-09
cd07295116 cd07295, PX_Grd19, The phosphoinositide binding Ph 2e-09
cd07294132 cd07294, PX_SNX12, The phosphoinositide binding Ph 7e-08
cd07280120 cd07280, PX_YPT35, The phosphoinositide binding Ph 9e-08
cd07293123 cd07293, PX_SNX3, The phosphoinositide binding Pho 1e-07
cd07286127 cd07286, PX_SNX18, The phosphoinositide binding Ph 2e-07
cd06897108 cd06897, PX_SNARE, The phosphoinositide binding Ph 1e-06
cd07285126 cd07285, PX_SNX9, The phosphoinositide binding Pho 2e-06
cd07282124 cd07282, PX_SNX2, The phosphoinositide binding Pho 3e-06
cd06871120 cd06871, PX_MONaKA, The phosphoinositide binding P 5e-06
cd07281124 cd07281, PX_SNX1, The phosphoinositide binding Pho 1e-05
cd07291141 cd07291, PX_SNX5, The phosphoinositide binding Pho 3e-05
cd06892141 cd06892, PX_SNX5_like, The phosphoinositide bindin 8e-05
cd06873120 cd06873, PX_SNX13, The phosphoinositide binding Ph 2e-04
cd07622201 cd07622, BAR_SNX4, The Bin/Amphiphysin/Rvs (BAR) d 4e-04
cd06869119 cd06869, PX_UP2_fungi, The phosphoinositide bindin 5e-04
cd06877119 cd06877, PX_SNX14, The phosphoinositide binding Ph 5e-04
cd07276110 cd07276, PX_SNX16, The phosphoinositide binding Ph 0.001
cd06868120 cd06868, PX_HS1BP3, The phosphoinositide binding P 0.003
cd06893132 cd06893, PX_SNX19, The phosphoinositide binding Ph 0.003
>gnl|CDD|153308 cd07624, BAR_SNX7_30, The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 7 and 30 Back     alignment and domain information
 Score =  142 bits (360), Expect = 5e-41
 Identities = 75/237 (31%), Positives = 119/237 (50%), Gaps = 50/237 (21%)

Query: 114 NIYTTMS-LRHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQFAIVLNT 172
              +TM  L++   EF++ ++Y++   EK+   E+I  R++KER +Y  E  +++ +   
Sbjct: 1   RNTSTMYLLKNRSPEFDKMNEYLTLFGEKLGTIERISQRIHKERIEYFDELKEYSPIFQL 60

Query: 173 WAGYEPQLSSVIRQVSKAVDT-TASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARR 231
           W+  E +L+ ++  VS AV+  TA+L   L    F      P+++YL+Y DAVK VL RR
Sbjct: 61  WSASETELAPLLEGVSSAVERCTAALEVLLSDHEFVFLP--PLREYLLYSDAVKDVLKRR 118

Query: 232 DVIQAEHDMCGEELQKKTAEKEQLTNKDSDSSSPTSSTATSSTNSYSLWKSTSEDRLEKL 291
           D  Q E+++  EEL KK  E                                        
Sbjct: 119 DQFQIEYELSVEELNKKRLE---------------------------------------- 138

Query: 292 STAIPKLTSQLEICDEKLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYYQQ 348
                 L  ++E   +KL+ AN  L++DLERW+  K+ DLKKILL +A++QI YY+Q
Sbjct: 139 ------LLKEVEKLQDKLECANADLKADLERWKQNKRQDLKKILLDMAEKQIQYYEQ 189


BAR domains are dimerization, lipid binding and curvature sensing modules found in many different proteins with diverse functions. Sorting nexins (SNXs) are Phox homology (PX) domain containing proteins that are involved in regulating membrane traffic and protein sorting in the endosomal system. SNXs differ from each other in their lipid-binding specificity, subcellular localization and specific function in the endocytic pathway. A subset of SNXs also contain BAR domains. The PX-BAR structural unit determines the specific membrane targeting of SNXs. This subfamily consists of SNX7, SNX30, and similar proteins. The specific functions of SNX7 and SNX30 have not been elucidated. BAR domains form dimers that bind to membranes, induce membrane bending and curvature, and may also be involved in protein-protein interactions. Length = 200

>gnl|CDD|132770 cd06860, PX_SNX7_30_like, The phosphoinositide binding Phox Homology domain of Sorting Nexins 7 and 30 Back     alignment and domain information
>gnl|CDD|153351 cd07667, BAR_SNX30, The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 30 Back     alignment and domain information
>gnl|CDD|153350 cd07666, BAR_SNX7, The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7 Back     alignment and domain information
>gnl|CDD|132816 cd07283, PX_SNX30, The phosphoinositide binding Phox Homology domain of Sorting Nexin 30 Back     alignment and domain information
>gnl|CDD|132773 cd06863, PX_Atg24p, The phosphoinositide binding Phox Homology domain of yeast Atg24p, an autophagic degradation protein Back     alignment and domain information
>gnl|CDD|132769 cd06859, PX_SNX1_2_like, The phosphoinositide binding Phox Homology domain of Sorting Nexins 1 and 2 Back     alignment and domain information
>gnl|CDD|132817 cd07284, PX_SNX7, The phosphoinositide binding Phox Homology domain of Sorting Nexin 7 Back     alignment and domain information
>gnl|CDD|153280 cd07596, BAR_SNX, The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins Back     alignment and domain information
>gnl|CDD|227680 COG5391, COG5391, Phox homology (PX) domain protein [Intracellular trafficking and secretion / General function prediction only] Back     alignment and domain information
>gnl|CDD|216119 pfam00787, PX, PX domain Back     alignment and domain information
>gnl|CDD|132768 cd06093, PX_domain, The Phox Homology domain, a phosphoinositide binding module Back     alignment and domain information
>gnl|CDD|132774 cd06864, PX_SNX4, The phosphoinositide binding Phox Homology domain of Sorting Nexin 4 Back     alignment and domain information
>gnl|CDD|132772 cd06862, PX_SNX9_18_like, The phosphoinositide binding Phox Homology domain of Sorting Nexins 9 and 18 Back     alignment and domain information
>gnl|CDD|132771 cd06861, PX_Vps5p, The phosphoinositide binding Phox Homology domain of yeast sorting nexin Vps5p Back     alignment and domain information
>gnl|CDD|214610 smart00312, PX, PhoX homologous domain, present in p47phox and p40phox Back     alignment and domain information
>gnl|CDD|132777 cd06867, PX_SNX41_42, The phosphoinositide binding Phox Homology domain of fungal Sorting Nexins 41 and 42 Back     alignment and domain information
>gnl|CDD|132775 cd06865, PX_SNX_like, The phosphoinositide binding Phox Homology domain of SNX-like proteins Back     alignment and domain information
>gnl|CDD|132776 cd06866, PX_SNX8_Mvp1p_like, The phosphoinositide binding Phox Homology domain of Sorting Nexin 8 and yeast Mvp1p Back     alignment and domain information
>gnl|CDD|132804 cd06894, PX_SNX3_like, The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 and related proteins Back     alignment and domain information
>gnl|CDD|132808 cd06898, PX_SNX10, The phosphoinositide binding Phox Homology domain of Sorting Nexin 10 Back     alignment and domain information
>gnl|CDD|132828 cd07295, PX_Grd19, The phosphoinositide binding Phox Homology domain of fungal Grd19 Back     alignment and domain information
>gnl|CDD|132827 cd07294, PX_SNX12, The phosphoinositide binding Phox Homology domain of Sorting Nexin 12 Back     alignment and domain information
>gnl|CDD|132813 cd07280, PX_YPT35, The phosphoinositide binding Phox Homology domain of the fungal protein YPT35 Back     alignment and domain information
>gnl|CDD|132826 cd07293, PX_SNX3, The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 Back     alignment and domain information
>gnl|CDD|132819 cd07286, PX_SNX18, The phosphoinositide binding Phox Homology domain of Sorting Nexin 18 Back     alignment and domain information
>gnl|CDD|132807 cd06897, PX_SNARE, The phosphoinositide binding Phox Homology domain of SNARE proteins from fungi Back     alignment and domain information
>gnl|CDD|132818 cd07285, PX_SNX9, The phosphoinositide binding Phox Homology domain of Sorting Nexin 9 Back     alignment and domain information
>gnl|CDD|132815 cd07282, PX_SNX2, The phosphoinositide binding Phox Homology domain of Sorting Nexin 2 Back     alignment and domain information
>gnl|CDD|132781 cd06871, PX_MONaKA, The phosphoinositide binding Phox Homology domain of Modulator of Na,K-ATPase Back     alignment and domain information
>gnl|CDD|132814 cd07281, PX_SNX1, The phosphoinositide binding Phox Homology domain of Sorting Nexin 1 Back     alignment and domain information
>gnl|CDD|132824 cd07291, PX_SNX5, The phosphoinositide binding Phox Homology domain of Sorting Nexin 5 Back     alignment and domain information
>gnl|CDD|132802 cd06892, PX_SNX5_like, The phosphoinositide binding Phox Homology domain of Sorting Nexins 5 and 6 Back     alignment and domain information
>gnl|CDD|132783 cd06873, PX_SNX13, The phosphoinositide binding Phox Homology domain of Sorting Nexin 13 Back     alignment and domain information
>gnl|CDD|153306 cd07622, BAR_SNX4, The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 4 Back     alignment and domain information
>gnl|CDD|132779 cd06869, PX_UP2_fungi, The phosphoinositide binding Phox Homology domain of uncharacterized fungal proteins Back     alignment and domain information
>gnl|CDD|132787 cd06877, PX_SNX14, The phosphoinositide binding Phox Homology domain of Sorting Nexin 14 Back     alignment and domain information
>gnl|CDD|132809 cd07276, PX_SNX16, The phosphoinositide binding Phox Homology domain of Sorting Nexin 16 Back     alignment and domain information
>gnl|CDD|132778 cd06868, PX_HS1BP3, The phosphoinositide binding Phox Homology domain of HS1BP3 Back     alignment and domain information
>gnl|CDD|132803 cd06893, PX_SNX19, The phosphoinositide binding Phox Homology domain of Sorting Nexin 19 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 357
KOG2273|consensus503 100.0
cd07666243 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of S 100.0
cd07667240 BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07664234 BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of S 100.0
cd07665234 BAR_SNX1 The Bin/Amphiphysin/Rvs (BAR) domain of S 100.0
PF09325236 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp 100.0
cd07627216 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07623224 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of 100.0
cd07624200 BAR_SNX7_30 The Bin/Amphiphysin/Rvs (BAR) domain o 100.0
KOG1660|consensus399 100.0
cd07596218 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So 99.97
cd07662218 BAR_SNX6 The Bin/Amphiphysin/Rvs (BAR) domain of S 99.97
cd07621219 BAR_SNX5_6 The Bin/Amphiphysin/Rvs (BAR) domain of 99.97
cd07663218 BAR_SNX5 The Bin/Amphiphysin/Rvs (BAR) domain of S 99.97
cd07622201 BAR_SNX4 The Bin/Amphiphysin/Rvs (BAR) domain of S 99.97
cd07625230 BAR_Vps17p The Bin/Amphiphysin/Rvs (BAR) domain of 99.96
cd07628185 BAR_Atg24p The Bin/Amphiphysin/Rvs (BAR) domain of 99.96
cd07630198 BAR_SNX_like The Bin/Amphiphysin/Rvs (BAR) domain 99.96
COG5391524 Phox homology (PX) domain protein [Intracellular t 99.95
cd07284116 PX_SNX7 The phosphoinositide binding Phox Homology 99.95
cd07283116 PX_SNX30 The phosphoinositide binding Phox Homolog 99.95
KOG2528|consensus490 99.94
cd07286127 PX_SNX18 The phosphoinositide binding Phox Homolog 99.94
cd06891140 PX_Vps17p The phosphoinositide binding Phox Homolo 99.94
cd06860116 PX_SNX7_30_like The phosphoinositide binding Phox 99.94
cd07629187 BAR_Atg20p The Bin/Amphiphysin/Rvs (BAR) domain of 99.93
cd07291141 PX_SNX5 The phosphoinositide binding Phox Homology 99.93
cd07292141 PX_SNX6 The phosphoinositide binding Phox Homology 99.93
cd07285126 PX_SNX9 The phosphoinositide binding Phox Homology 99.93
cd07282124 PX_SNX2 The phosphoinositide binding Phox Homology 99.92
cd07293123 PX_SNX3 The phosphoinositide binding Phox Homology 99.92
cd06861112 PX_Vps5p The phosphoinositide binding Phox Homolog 99.92
cd06892141 PX_SNX5_like The phosphoinositide binding Phox Hom 99.92
cd07294132 PX_SNX12 The phosphoinositide binding Phox Homolog 99.91
cd07295116 PX_Grd19 The phosphoinositide binding Phox Homolog 99.91
cd06894123 PX_SNX3_like The phosphoinositide binding Phox Hom 99.91
cd06865120 PX_SNX_like The phosphoinositide binding Phox Homo 99.91
cd06863118 PX_Atg24p The phosphoinositide binding Phox Homolo 99.91
cd06864129 PX_SNX4 The phosphoinositide binding Phox Homology 99.9
cd07281124 PX_SNX1 The phosphoinositide binding Phox Homology 99.89
cd06898113 PX_SNX10 The phosphoinositide binding Phox Homolog 99.89
cd06866105 PX_SNX8_Mvp1p_like The phosphoinositide binding Ph 99.88
cd07598211 BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of 99.88
cd07288118 PX_SNX15 The phosphoinositide binding Phox Homolog 99.88
cd06867112 PX_SNX41_42 The phosphoinositide binding Phox Homo 99.88
cd06862125 PX_SNX9_18_like The phosphoinositide binding Phox 99.88
cd06868120 PX_HS1BP3 The phosphoinositide binding Phox Homolo 99.88
cd06859114 PX_SNX1_2_like The phosphoinositide binding Phox H 99.86
cd06877119 PX_SNX14 The phosphoinositide binding Phox Homolog 99.86
cd07287118 PX_RPK118_like The phosphoinositide binding Phox H 99.86
cd07300114 PX_SNX20 The phosphoinositide binding Phox Homolog 99.86
cd06879138 PX_UP1_plant The phosphoinositide binding Phox Hom 99.85
cd07280120 PX_YPT35 The phosphoinositide binding Phox Homolog 99.85
cd07279112 PX_SNX20_21_like The phosphoinositide binding Phox 99.85
cd07301112 PX_SNX21 The phosphoinositide binding Phox Homolog 99.85
cd06881117 PX_SNX15_like The phosphoinositide binding Phox Ho 99.84
KOG2527|consensus144 99.83
cd07276110 PX_SNX16 The phosphoinositide binding Phox Homolog 99.82
cd07597246 BAR_SNX8 The Bin/Amphiphysin/Rvs (BAR) domain of S 99.81
cd06893132 PX_SNX19 The phosphoinositide binding Phox Homolog 99.81
cd06870109 PX_CISK The phosphoinositide binding Phox Homology 99.81
cd06886106 PX_SNX27 The phosphoinositide binding Phox Homolog 99.81
cd06897108 PX_SNARE The phosphoinositide binding Phox Homolog 99.8
cd06871120 PX_MONaKA The phosphoinositide binding Phox Homolo 99.78
cd06869119 PX_UP2_fungi The phosphoinositide binding Phox Hom 99.77
cd06872107 PX_SNX19_like_plant The phosphoinositide binding P 99.77
cd06873120 PX_SNX13 The phosphoinositide binding Phox Homolog 99.76
cd06885104 PX_SNX17_31 The phosphoinositide binding Phox Homo 99.76
cd06876133 PX_MDM1p The phosphoinositide binding Phox Homolog 99.75
cd06875116 PX_IRAS The phosphoinositide binding Phox Homology 99.75
cd06878127 PX_SNX25 The phosphoinositide binding Phox Homolog 99.74
cd07626199 BAR_SNX9_like The Bin/Amphiphysin/Rvs (BAR) domain 99.73
smart00312105 PX PhoX homologous domain, present in p47phox and 99.72
cd06882123 PX_p40phox The phosphoinositide binding Phox Homol 99.72
cd07277118 PX_RUN The phosphoinositide binding Phox Homology 99.68
cd06880110 PX_SNX22 The phosphoinositide binding Phox Homolog 99.68
cd06093106 PX_domain The Phox Homology domain, a phosphoinosi 99.66
cd06883109 PX_PI3K_C2 The phosphoinositide binding Phox Homol 99.66
PF00787113 PX: PX domain; InterPro: IPR001683 The PX (phox) d 99.63
cd06884111 PX_PI3K_C2_68D The phosphoinositide binding Phox H 99.55
cd06890112 PX_Bem1p The phosphoinositide binding Phox Homolog 99.53
cd06874127 PX_KIF16B_SNX23 The phosphoinositide binding Phox 99.52
PF10456237 BAR_3_WASP_bdg: WASP-binding domain of Sorting nex 99.52
cd06895140 PX_PLD The phosphoinositide binding Phox Homology 99.49
cd07307194 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimeri 99.47
cd06887118 PX_p47phox The phosphoinositide binding Phox Homol 99.46
cd07670207 BAR_SNX18 The Bin/Amphiphysin/Rvs (BAR) domain of 99.46
cd07669207 BAR_SNX33 The Bin/Amphiphysin/Rvs (BAR) domain of 99.45
cd07668210 BAR_SNX9 The Bin/Amphiphysin/Rvs (BAR) domain of S 99.44
cd06888119 PX_FISH The phosphoinositide binding Phox Homology 99.41
cd07590225 BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of B 99.4
cd07290109 PX_PI3K_C2_beta The phosphoinositide binding Phox 99.38
cd07588211 BAR_Amphiphysin The Bin/Amphiphysin/Rvs (BAR) doma 99.37
cd07611211 BAR_Amphiphysin_I_II The Bin/Amphiphysin/Rvs (BAR) 99.32
PF06730219 FAM92: FAM92 protein; InterPro: IPR009602 This fam 99.32
PF03114229 BAR: BAR domain; InterPro: IPR004148 Endocytosis a 99.31
cd07591224 BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain o 99.26
cd07289109 PX_PI3K_C2_alpha The phosphoinositide binding Phox 99.26
cd07612211 BAR_Bin2 The Bin/Amphiphysin/Rvs (BAR) domain of B 99.22
cd07599216 BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain o 99.19
cd07296135 PX_PLD1 The phosphoinositide binding Phox Homology 99.15
smart00721239 BAR BAR domain. 99.14
cd07589195 BAR_DNMBP The Bin/Amphiphysin/Rvs (BAR) domain of 99.08
cd06889121 PX_NoxO1 The phosphoinositide binding Phox Homolog 98.98
KOG3771|consensus 460 98.88
cd06896101 PX_PI3K_C2_gamma The phosphoinositide binding Phox 98.77
cd07603200 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of 98.64
cd07593215 BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) dom 98.64
cd07604215 BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of 98.58
cd07601215 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of A 98.52
cd07602207 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR 98.5
cd07606202 BAR_SFC_plant The Bin/Amphiphysin/Rvs (BAR) domain 98.5
cd07637200 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of 98.47
cd07595244 BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) 98.46
cd07638200 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of 98.45
cd07639200 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of 98.43
cd07297130 PX_PLD2 The phosphoinositide binding Phox Homology 98.42
cd07594229 BAR_Endophilin_B The Bin/Amphiphysin/Rvs (BAR) dom 98.35
cd07619248 BAR_Rich2 The Bin/Amphiphysin/Rvs (BAR) domain of 98.32
KOG1259|consensus 490 98.31
cd07620257 BAR_SH3BP1 The Bin/Amphiphysin/Rvs (BAR) domain of 98.29
KOG3784|consensus407 98.28
cd07615223 BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) do 98.23
cd07618246 BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of 98.21
cd07592223 BAR_Endophilin_A The Bin/Amphiphysin/Rvs (BAR) dom 98.14
PF06456229 Arfaptin: Arfaptin-like domain; InterPro: IPR01050 98.14
cd07660201 BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain 98.13
cd07614223 BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) do 98.12
cd07635207 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of 98.09
cd07636207 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of G 98.06
cd07613223 BAR_Endophilin_A1 The Bin/Amphiphysin/Rvs (BAR) do 98.05
cd07642215 BAR_ASAP2 The Bin/Amphiphysin/Rvs (BAR) domain of 98.04
cd00011203 BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) do 98.0
PF08397219 IMD: IRSp53/MIM homology domain; InterPro: IPR0136 97.99
cd07600242 BAR_Gvp36 The Bin/Amphiphysin/Rvs (BAR) domain of 97.96
cd07616229 BAR_Endophilin_B1 The Bin/Amphiphysin/Rvs (BAR) do 97.94
cd07641215 BAR_ASAP1 The Bin/Amphiphysin/Rvs (BAR) domain of 97.92
cd07634207 BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domai 97.88
cd07617220 BAR_Endophilin_B2 The Bin/Amphiphysin/Rvs (BAR) do 97.73
cd07605223 I-BAR_IMD Inverse (I)-BAR, also known as the IRSp5 97.61
PF13805271 Pil1: Eisosome component PIL1; PDB: 3PLT_B. 97.44
cd07645226 I-BAR_IMD_BAIAP2L1 Inverse (I)-BAR, also known as 97.37
cd07632215 BAR_APPL2 The Bin/Amphiphysin/Rvs (BAR) domain of 97.34
cd07653251 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and B 97.28
KOG2101|consensus362 97.27
cd07646232 I-BAR_IMD_IRSp53 Inverse (I)-BAR, also known as th 97.26
cd07633207 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of 97.25
cd07649233 F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Am 97.22
cd07659215 BAR_PICK1 The Bin/Amphiphysin/Rvs (BAR) domain of 97.05
cd07655258 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/ 97.03
cd07631215 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of 97.0
cd07640213 BAR_ASAP3 The Bin/Amphiphysin/Rvs (BAR) domain of 96.96
KOG1118|consensus366 96.89
cd07658239 F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin 96.8
cd07298115 PX_RICS The phosphoinositide binding Phox Homology 96.78
PF10455289 BAR_2: Bin/amphiphysin/Rvs domain for vesicular tr 96.51
KOG4773|consensus386 96.43
cd07651236 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology 96.33
cd07648261 F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Am 96.19
KOG3876|consensus341 96.1
KOG0521|consensus 785 95.64
cd07674261 F-BAR_FCHO1 The F-BAR (FES-CIP4 Homology and Bin/A 95.39
KOG3651|consensus429 95.31
cd07661204 BAR_ICA69 The Bin/Amphiphysin/Rvs (BAR) domain of 95.31
PF09325236 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vp 95.29
cd07596218 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of So 95.14
cd07299113 PX_TCGAP The phosphoinositide binding Phox Homolog 95.11
KOG0905|consensus1639 95.07
cd07676253 F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/A 94.94
cd07650228 F-BAR_Syp1p_like The F-BAR (FES-CIP4 Homology and 94.86
cd07680258 F-BAR_PACSIN1 The F-BAR (FES-CIP4 Homology and Bin 94.85
cd07681258 F-BAR_PACSIN3 The F-BAR (FES-CIP4 Homology and Bin 94.8
cd07643231 I-BAR_IMD_MIM Inverse (I)-BAR, also known as the I 94.73
cd07278114 PX_RICS_like The phosphoinositide binding Phox Hom 94.69
cd07672240 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin 94.4
cd07679258 F-BAR_PACSIN2 The F-BAR (FES-CIP4 Homology and Bin 94.38
cd07673269 F-BAR_FCHO2 The F-BAR (FES-CIP4 Homology and Bin/A 94.2
KOG3725|consensus 375 93.0
cd07686234 F-BAR_Fer The F-BAR (FES-CIP4 Homology and Bin/Amp 92.84
cd07647239 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/ 92.18
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 91.94
COG5391524 Phox homology (PX) domain protein [Intracellular t 91.62
cd07657237 F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin 91.11
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 90.9
KOG1451|consensus 812 90.69
cd07651236 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology 90.46
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 90.11
cd07671242 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin 89.81
KOG2273|consensus503 88.88
PRK11546143 zraP zinc resistance protein; Provisional 88.03
cd07610191 FCH_F-BAR The Extended FES-CIP4 Homology (FCH) or 86.28
cd07307194 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimeri 85.98
PF04048142 Sec8_exocyst: Sec8 exocyst complex component speci 85.75
cd07598211 BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of 85.71
cd07655258 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/ 85.47
KOG4460|consensus741 81.73
cd07627216 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of 81.71
PF15642 385 Tox-ODYAM1: Toxin in Odyssella and Amoebophilus 80.87
>KOG2273|consensus Back     alignment and domain information
Probab=100.00  E-value=3e-40  Score=326.64  Aligned_cols=338  Identities=27%  Similarity=0.449  Sum_probs=278.7

Q ss_pred             CCCCCCcceeecchhhHHHHHHHHHHhCCCCCCCCCCCccccch-hhhcCCHHHHHHHHHHHHHHHHHHHcCccccCChh
Q psy18202          1 PEFPDTECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSLLE-HLNRYSKEFILCRMKLLDQFLRRVTSHPVLSVNSH   79 (357)
Q Consensus         1 p~f~~~~~~V~RRysdF~~L~~~L~~~~p~~~iPplP~K~~~~~-~~~~~~~~fie~R~~~L~~fL~~i~~hp~L~~~~~   79 (357)
                      |.|....+.|+|||+||.|||+.|...|||++|||+|+|....+ .++.++++|+++||++|++||++|+.||+|++++.
T Consensus       140 ~~~~~~~~~V~RrysDF~~L~~~L~~~~p~~~iPplP~k~~~~~~~~~~~s~ef~e~rr~~L~~~l~r~~~hP~l~~~~~  219 (503)
T KOG2273|consen  140 PIFGSSEFSVRRRYSDFLWLRSKLLSKYPGRIIPPLPEKSIVGSKSGDSFSDEFIEKRRKALERFLNRLSLHPVLSNDED  219 (503)
T ss_pred             CcCCCCceeEEeehhHHHHHHHHHHHHCCCCeeCCCCchhhhhccccCCCCHHHHHHHHHHHHHHHHHHhcCcccccCHH
Confidence            67888899999999999999999999999999999999999855 44678999999999999999999999999999999


Q ss_pred             hhccccccc----cchhhcccCCCCc-----cccch-hhhhhhhhhhccccccCCChhHHHHHHHHHHHHHHHHHHHHHH
Q psy18202         80 AIIFLTAKL----AEFSMHKKHSPGL-----LNKMS-ESFYNLTNIYTTMSLRHHHSEFEQFSQYISNLYEKISAFEKIG  149 (357)
Q Consensus        80 ~~~FL~~~~----~~~~~~~k~~~~~-----~~~~~-~~~~~~~~~~~~~~~~e~d~~f~~~~~~~~~l~~~l~~l~~~~  149 (357)
                      |..||+.+.    ++...+.+++.+.     ++... .....+...+..  +.+.+++|.+..+++++++..+..+.+.+
T Consensus       220 ~~~FL~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~f~e~~~~i~~l~~~l~~l~~~~  297 (503)
T KOG2273|consen  220 FRLFLESDSKELPTDVNSRFKSGADLLSKQFFGETSSTDAVSLLPSFKK--FKESDKEFTEKKEKIDKLEQQLKKLSKQV  297 (503)
T ss_pred             HHHHhcccccccchhhHHHHhcchhhccccccCcccchhhhhccccccc--cccCcHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999994    2333334443332     22222 111111112222  67789999999999999999999999999


Q ss_pred             HHHHHhhHHHHHHHHHHHHHHHHhhCCch---hHHHHHHHHHHHHHHHHHHHHHHh-hhhhhhhcchhHHHHHHHHHHHH
Q psy18202        150 TRLYKERKDYVSEAHQFAIVLNTWAGYEP---QLSSVIRQVSKAVDTTASLHKNLL-IEPFHEHNSHPMKDYLMYIDAVK  225 (357)
Q Consensus       150 ~~l~k~~~~l~~~~~~~~~~~~~l~~~E~---~l~~~l~~~~~~~~~~~~~~~~~~-~~~~~~~l~~~l~~~~~~~~a~k  225 (357)
                      .+++..+..++..+.++|.++..|+.++.   .++..+..++.+...++...++ . .......+.+.+++|++++++++
T Consensus       298 ~~~~~~~~~l~~~~~~~g~~~~~l~~~~~~~~~l~~~~~~~~~~~~~~~~~~e~-~~~~~~~~~~~~~l~~~i~~~~~~k  376 (503)
T KOG2273|consen  298 QRLVKRRRELASNLAELGKALAQLSALEGETDELSEALSGLAKVIESLSKLLEK-LTAEKDSKKLAEQLREYIRYLESVK  376 (503)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhhhchHHHHHHHHHHHHHHHHHHHHHHH-hhhhhhHHHhHHHHHHHHHHHHHHH
Confidence            99999999999999999999999998765   6889999999999999988877 5 55556799999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCCCCCCCCCcccCCCcccccCCc-c--HHHHHHHHhhHhHHHHHH
Q psy18202        226 QVLARRDVIQAEHDMCGEELQKKTAEKEQLTNKDSDSSSPTSSTATSSTNSYSLWKST-S--EDRLEKLSTAIPKLTSQL  302 (357)
Q Consensus       226 ~~l~~R~~~~~~~~~~~~~l~kk~~~~~kL~~~~~~~~~~~~~~~~~~~~g~~~~~~~-~--~~ki~~l~~~i~~le~~~  302 (357)
                      .++..|..++..++.++..+.+++....++...+.                .+++... +  ..++.+++.++..+++.+
T Consensus       377 ~~~~~r~~~~~~~~~~~~~~~~~~e~~~~~~~~~~----------------~~~~~~k~~~~~~e~~~~~~~~~~~~~~~  440 (503)
T KOG2273|consen  377 SLFEQRSKALQKLQEAQRELSSKKEQLSKLKKKNR----------------SSFGFDKIDLAEKEIEKLEEKVNELEELL  440 (503)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHhhh----------------hhhccchhHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999988886620                0000000 1  155555566666666666


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccccC
Q psy18202        303 EICDEKLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYYQQRSDRGNCNC  357 (357)
Q Consensus       303 ~~~~~~~~~i~~~~~~El~rF~~~k~~~l~~~l~~~a~~qi~~~~~~~~~W~~~~  357 (357)
                      ...+..+..|++.+..|+.+|...+..||+.++..|++.+++++++++++|...+
T Consensus       441 ~~~~~~~~~i~~~~~~e~~~f~~~~~~d~~~~~~~~~d~~i~~~~~~l~~W~~~~  495 (503)
T KOG2273|consen  441 ALKELELDEISERIRAELERFEESRRQDFKESLKKYADLHVEYAEQILKAWEKFL  495 (503)
T ss_pred             HhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            6555566699999999999999999999999999999999999999999998653



>cd07666 BAR_SNX7 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 7 Back     alignment and domain information
>cd07667 BAR_SNX30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 30 Back     alignment and domain information
>cd07664 BAR_SNX2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 2 Back     alignment and domain information
>cd07665 BAR_SNX1 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 1 Back     alignment and domain information
>PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking Back     alignment and domain information
>cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p Back     alignment and domain information
>cd07623 BAR_SNX1_2 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 1 and 2 Back     alignment and domain information
>cd07624 BAR_SNX7_30 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 7 and 30 Back     alignment and domain information
>KOG1660|consensus Back     alignment and domain information
>cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins Back     alignment and domain information
>cd07662 BAR_SNX6 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 6 Back     alignment and domain information
>cd07621 BAR_SNX5_6 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins 5 and 6 Back     alignment and domain information
>cd07663 BAR_SNX5 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 5 Back     alignment and domain information
>cd07622 BAR_SNX4 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 4 Back     alignment and domain information
>cd07625 BAR_Vps17p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps17p Back     alignment and domain information
>cd07628 BAR_Atg24p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Atg24p Back     alignment and domain information
>cd07630 BAR_SNX_like The Bin/Amphiphysin/Rvs (BAR) domain of uncharacterized Sorting Nexins Back     alignment and domain information
>COG5391 Phox homology (PX) domain protein [Intracellular trafficking and secretion / General function prediction only] Back     alignment and domain information
>cd07284 PX_SNX7 The phosphoinositide binding Phox Homology domain of Sorting Nexin 7 Back     alignment and domain information
>cd07283 PX_SNX30 The phosphoinositide binding Phox Homology domain of Sorting Nexin 30 Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>cd07286 PX_SNX18 The phosphoinositide binding Phox Homology domain of Sorting Nexin 18 Back     alignment and domain information
>cd06891 PX_Vps17p The phosphoinositide binding Phox Homology domain of yeast sorting nexin Vps17p Back     alignment and domain information
>cd06860 PX_SNX7_30_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 7 and 30 Back     alignment and domain information
>cd07629 BAR_Atg20p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Atg20p Back     alignment and domain information
>cd07291 PX_SNX5 The phosphoinositide binding Phox Homology domain of Sorting Nexin 5 Back     alignment and domain information
>cd07292 PX_SNX6 The phosphoinositide binding Phox Homology domain of Sorting Nexin 6 Back     alignment and domain information
>cd07285 PX_SNX9 The phosphoinositide binding Phox Homology domain of Sorting Nexin 9 Back     alignment and domain information
>cd07282 PX_SNX2 The phosphoinositide binding Phox Homology domain of Sorting Nexin 2 Back     alignment and domain information
>cd07293 PX_SNX3 The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 Back     alignment and domain information
>cd06861 PX_Vps5p The phosphoinositide binding Phox Homology domain of yeast sorting nexin Vps5p Back     alignment and domain information
>cd06892 PX_SNX5_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 5 and 6 Back     alignment and domain information
>cd07294 PX_SNX12 The phosphoinositide binding Phox Homology domain of Sorting Nexin 12 Back     alignment and domain information
>cd07295 PX_Grd19 The phosphoinositide binding Phox Homology domain of fungal Grd19 Back     alignment and domain information
>cd06894 PX_SNX3_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 3 and related proteins Back     alignment and domain information
>cd06865 PX_SNX_like The phosphoinositide binding Phox Homology domain of SNX-like proteins Back     alignment and domain information
>cd06863 PX_Atg24p The phosphoinositide binding Phox Homology domain of yeast Atg24p, an autophagic degradation protein Back     alignment and domain information
>cd06864 PX_SNX4 The phosphoinositide binding Phox Homology domain of Sorting Nexin 4 Back     alignment and domain information
>cd07281 PX_SNX1 The phosphoinositide binding Phox Homology domain of Sorting Nexin 1 Back     alignment and domain information
>cd06898 PX_SNX10 The phosphoinositide binding Phox Homology domain of Sorting Nexin 10 Back     alignment and domain information
>cd06866 PX_SNX8_Mvp1p_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 8 and yeast Mvp1p Back     alignment and domain information
>cd07598 BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of Family with sequence similarity 92 (FAM92) Back     alignment and domain information
>cd07288 PX_SNX15 The phosphoinositide binding Phox Homology domain of Sorting Nexin 15 Back     alignment and domain information
>cd06867 PX_SNX41_42 The phosphoinositide binding Phox Homology domain of fungal Sorting Nexins 41 and 42 Back     alignment and domain information
>cd06862 PX_SNX9_18_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 9 and 18 Back     alignment and domain information
>cd06868 PX_HS1BP3 The phosphoinositide binding Phox Homology domain of HS1BP3 Back     alignment and domain information
>cd06859 PX_SNX1_2_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 1 and 2 Back     alignment and domain information
>cd06877 PX_SNX14 The phosphoinositide binding Phox Homology domain of Sorting Nexin 14 Back     alignment and domain information
>cd07287 PX_RPK118_like The phosphoinositide binding Phox Homology domain of RPK118-like proteins Back     alignment and domain information
>cd07300 PX_SNX20 The phosphoinositide binding Phox Homology domain of Sorting Nexin 20 Back     alignment and domain information
>cd06879 PX_UP1_plant The phosphoinositide binding Phox Homology domain of uncharacterized plant proteins Back     alignment and domain information
>cd07280 PX_YPT35 The phosphoinositide binding Phox Homology domain of the fungal protein YPT35 Back     alignment and domain information
>cd07279 PX_SNX20_21_like The phosphoinositide binding Phox Homology domain of Sorting Nexins 20 and 21 Back     alignment and domain information
>cd07301 PX_SNX21 The phosphoinositide binding Phox Homology domain of Sorting Nexin 21 Back     alignment and domain information
>cd06881 PX_SNX15_like The phosphoinositide binding Phox Homology domain of Sorting Nexin 15-like proteins Back     alignment and domain information
>KOG2527|consensus Back     alignment and domain information
>cd07276 PX_SNX16 The phosphoinositide binding Phox Homology domain of Sorting Nexin 16 Back     alignment and domain information
>cd07597 BAR_SNX8 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 8 Back     alignment and domain information
>cd06893 PX_SNX19 The phosphoinositide binding Phox Homology domain of Sorting Nexin 19 Back     alignment and domain information
>cd06870 PX_CISK The phosphoinositide binding Phox Homology Domain of Cytokine-Independent Survival Kinase Back     alignment and domain information
>cd06886 PX_SNX27 The phosphoinositide binding Phox Homology domain of Sorting Nexin 27 Back     alignment and domain information
>cd06897 PX_SNARE The phosphoinositide binding Phox Homology domain of SNARE proteins from fungi Back     alignment and domain information
>cd06871 PX_MONaKA The phosphoinositide binding Phox Homology domain of Modulator of Na,K-ATPase Back     alignment and domain information
>cd06869 PX_UP2_fungi The phosphoinositide binding Phox Homology domain of uncharacterized fungal proteins Back     alignment and domain information
>cd06872 PX_SNX19_like_plant The phosphoinositide binding Phox Homology domain of uncharacterized SNX19-like plant proteins Back     alignment and domain information
>cd06873 PX_SNX13 The phosphoinositide binding Phox Homology domain of Sorting Nexin 13 Back     alignment and domain information
>cd06885 PX_SNX17_31 The phosphoinositide binding Phox Homology domain of Sorting Nexins 17 and 31 Back     alignment and domain information
>cd06876 PX_MDM1p The phosphoinositide binding Phox Homology domain of yeast MDM1p Back     alignment and domain information
>cd06875 PX_IRAS The phosphoinositide binding Phox Homology domain of the Imidazoline Receptor Antisera-Selected Back     alignment and domain information
>cd06878 PX_SNX25 The phosphoinositide binding Phox Homology domain of Sorting Nexin 25 Back     alignment and domain information
>cd07626 BAR_SNX9_like The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 9 and Similar Proteins Back     alignment and domain information
>smart00312 PX PhoX homologous domain, present in p47phox and p40phox Back     alignment and domain information
>cd06882 PX_p40phox The phosphoinositide binding Phox Homology domain of the p40phox subunit of NADPH oxidase Back     alignment and domain information
>cd07277 PX_RUN The phosphoinositide binding Phox Homology domain of uncharacterized proteins containing PX and RUN domains Back     alignment and domain information
>cd06880 PX_SNX22 The phosphoinositide binding Phox Homology domain of Sorting Nexin 22 Back     alignment and domain information
>cd06093 PX_domain The Phox Homology domain, a phosphoinositide binding module Back     alignment and domain information
>cd06883 PX_PI3K_C2 The phosphoinositide binding Phox Homology Domain of Class II Phosphoinositide 3-Kinases Back     alignment and domain information
>PF00787 PX: PX domain; InterPro: IPR001683 The PX (phox) domain [] occurs in a variety of eukaryotic proteins and have been implicated in highly diverse functions such as cell signalling, vesicular trafficking, protein sorting and lipid modification [, , ] Back     alignment and domain information
>cd06884 PX_PI3K_C2_68D The phosphoinositide binding Phox Homology Domain of Class II Phosphoinositide 3-Kinases similar to the Drosophila PI3K_68D protein Back     alignment and domain information
>cd06890 PX_Bem1p The phosphoinositide binding Phox Homology domain of Bem1p Back     alignment and domain information
>cd06874 PX_KIF16B_SNX23 The phosphoinositide binding Phox Homology domain of KIF16B kinesin or Sorting Nexin 23 Back     alignment and domain information
>PF10456 BAR_3_WASP_bdg: WASP-binding domain of Sorting nexin protein; InterPro: IPR019497 The C-terminal region of the Sorting nexin group of proteins appears to carry a BAR-like (Bin/amphiphysin/Rvs) domain Back     alignment and domain information
>cd06895 PX_PLD The phosphoinositide binding Phox Homology domain of Phospholipase D Back     alignment and domain information
>cd07307 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature Back     alignment and domain information
>cd06887 PX_p47phox The phosphoinositide binding Phox Homology domain of the p47phox subunit of NADPH oxidase Back     alignment and domain information
>cd07670 BAR_SNX18 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 18 Back     alignment and domain information
>cd07669 BAR_SNX33 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 33 Back     alignment and domain information
>cd07668 BAR_SNX9 The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexin 9 Back     alignment and domain information
>cd06888 PX_FISH The phosphoinositide binding Phox Homology domain of Five SH protein Back     alignment and domain information
>cd07590 BAR_Bin3 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 3 Back     alignment and domain information
>cd07290 PX_PI3K_C2_beta The phosphoinositide binding Phox Homology Domain of the Beta Isoform of Class II Phosphoinositide 3-Kinases Back     alignment and domain information
>cd07588 BAR_Amphiphysin The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysins Back     alignment and domain information
>cd07611 BAR_Amphiphysin_I_II The Bin/Amphiphysin/Rvs (BAR) domain of Amphiphysin I and II Back     alignment and domain information
>PF06730 FAM92: FAM92 protein; InterPro: IPR009602 This family consists of several eukaryotic sequences of around 270 residues in length Back     alignment and domain information
>PF03114 BAR: BAR domain; InterPro: IPR004148 Endocytosis and intracellular transport involve several mechanistic steps: (1) for the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton; (2) following its formation, the vesicle has to be pinched off the membrane; (3) the cargo has to be subsequently transported through the cell and the vesicle must fuse with the correct cellular compartment Back     alignment and domain information
>cd07591 BAR_Rvs161p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 161 and similar proteins Back     alignment and domain information
>cd07289 PX_PI3K_C2_alpha The phosphoinositide binding Phox Homology Domain of the Alpha Isoform of Class II Phosphoinositide 3-Kinases Back     alignment and domain information
>cd07612 BAR_Bin2 The Bin/Amphiphysin/Rvs (BAR) domain of Bridging integrator 2 Back     alignment and domain information
>cd07599 BAR_Rvs167p The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Reduced viability upon starvation protein 167 and similar proteins Back     alignment and domain information
>cd07296 PX_PLD1 The phosphoinositide binding Phox Homology domain of Phospholipase D1 Back     alignment and domain information
>smart00721 BAR BAR domain Back     alignment and domain information
>cd07589 BAR_DNMBP The Bin/Amphiphysin/Rvs (BAR) domain of Dynamin Binding Protein Back     alignment and domain information
>cd06889 PX_NoxO1 The phosphoinositide binding Phox Homology domain of Nox Organizing protein 1 Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>cd06896 PX_PI3K_C2_gamma The phosphoinositide binding Phox Homology Domain of the Gamma Isoform of Class II Phosphoinositide 3-Kinases Back     alignment and domain information
>cd07603 BAR_ACAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing proteins Back     alignment and domain information
>cd07593 BAR_MUG137_fungi The Bin/Amphiphysin/Rvs (BAR) domain of Schizosaccharomyces pombe Meiotically Up-regulated Gene 137 protein and similar proteins Back     alignment and domain information
>cd07604 BAR_ASAPs The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing proteins Back     alignment and domain information
>cd07601 BAR_APPL The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing proteins Back     alignment and domain information
>cd07602 BAR_RhoGAP_OPHN1-like The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin1-like Rho GTPase Activating Proteins Back     alignment and domain information
>cd07606 BAR_SFC_plant The Bin/Amphiphysin/Rvs (BAR) domain of the plant protein SCARFACE (SFC) Back     alignment and domain information
>cd07637 BAR_ACAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>cd07595 BAR_RhoGAP_Rich-like The Bin/Amphiphysin/Rvs (BAR) domain of Rich-like Rho GTPase Activating Proteins Back     alignment and domain information
>cd07638 BAR_ACAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>cd07639 BAR_ACAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with Coiled-coil, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>cd07297 PX_PLD2 The phosphoinositide binding Phox Homology domain of Phospholipase D2 Back     alignment and domain information
>cd07594 BAR_Endophilin_B The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B Back     alignment and domain information
>cd07619 BAR_Rich2 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 2 Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>cd07620 BAR_SH3BP1 The Bin/Amphiphysin/Rvs (BAR) domain of SH3-domain Binding Protein 1 Back     alignment and domain information
>KOG3784|consensus Back     alignment and domain information
>cd07615 BAR_Endophilin_A3 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A3 Back     alignment and domain information
>cd07618 BAR_Rich1 The Bin/Amphiphysin/Rvs (BAR) domain of RhoGAP interacting with CIP4 homologs protein 1 Back     alignment and domain information
>cd07592 BAR_Endophilin_A The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A Back     alignment and domain information
>PF06456 Arfaptin: Arfaptin-like domain; InterPro: IPR010504 Arfaptin interacts with ARF1, a small GTPase involved in vesicle budding at the Golgi complex and immature secretory granules Back     alignment and domain information
>cd07660 BAR_Arfaptin The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin Back     alignment and domain information
>cd07614 BAR_Endophilin_A2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A2 Back     alignment and domain information
>cd07635 BAR_GRAF2 The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion 2 Back     alignment and domain information
>cd07636 BAR_GRAF The Bin/Amphiphysin/Rvs (BAR) domain of GTPase Regulator Associated with Focal adhesion kinase Back     alignment and domain information
>cd07613 BAR_Endophilin_A1 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-A1 Back     alignment and domain information
>cd07642 BAR_ASAP2 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 2 Back     alignment and domain information
>cd00011 BAR_Arfaptin_like The Bin/Amphiphysin/Rvs (BAR) domain of Arfaptin-like proteins, a dimerization module that binds and bends membranes Back     alignment and domain information
>PF08397 IMD: IRSp53/MIM homology domain; InterPro: IPR013606 The IMD (IRSp53 and MIM (missing in metastases) homology) domain is a BAR-like domain of approximately 250 amino acids found at the N-terminal in the insulin receptor tyrosine kinase substrate p53 (IRSp53) and in the evolutionarily related IRSp53/MIM family Back     alignment and domain information
>cd07600 BAR_Gvp36 The Bin/Amphiphysin/Rvs (BAR) domain of Saccharomyces cerevisiae Golgi vesicle protein of 36 kDa and similar proteins Back     alignment and domain information
>cd07616 BAR_Endophilin_B1 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B1 Back     alignment and domain information
>cd07641 BAR_ASAP1 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 1 Back     alignment and domain information
>cd07634 BAR_GAP10-like The Bin/Amphiphysin/Rvs (BAR) domain of Rho GTPase activating protein 10-like Back     alignment and domain information
>cd07617 BAR_Endophilin_B2 The Bin/Amphiphysin/Rvs (BAR) domain of Endophilin-B2 Back     alignment and domain information
>cd07605 I-BAR_IMD Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), a dimerization module that binds and bends membranes Back     alignment and domain information
>PF13805 Pil1: Eisosome component PIL1; PDB: 3PLT_B Back     alignment and domain information
>cd07645 I-BAR_IMD_BAIAP2L1 Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2-Like 1 Back     alignment and domain information
>cd07632 BAR_APPL2 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 2 Back     alignment and domain information
>cd07653 F-BAR_CIP4-like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Cdc42-Interacting Protein 4 and similar proteins Back     alignment and domain information
>KOG2101|consensus Back     alignment and domain information
>cd07646 I-BAR_IMD_IRSp53 Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Insulin Receptor tyrosine kinase Substrate p53 Back     alignment and domain information
>cd07633 BAR_OPHN1 The Bin/Amphiphysin/Rvs (BAR) domain of Oligophrenin-1 Back     alignment and domain information
>cd07649 F-BAR_GAS7 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Growth Arrest Specific protein 7 Back     alignment and domain information
>cd07659 BAR_PICK1 The Bin/Amphiphysin/Rvs (BAR) domain of Protein Interacting with C Kinase 1 Back     alignment and domain information
>cd07655 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>cd07631 BAR_APPL1 The Bin/Amphiphysin/Rvs (BAR) domain of Adaptor protein, Phosphotyrosine interaction, PH domain and Leucine zipper containing 1 Back     alignment and domain information
>cd07640 BAR_ASAP3 The Bin/Amphiphysin/Rvs (BAR) domain of ArfGAP with SH3 domain, ANK repeat and PH domain containing protein 3 Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>cd07658 F-BAR_NOSTRIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Nitric Oxide Synthase TRaffic INducer (NOSTRIN) Back     alignment and domain information
>cd07298 PX_RICS The phosphoinositide binding Phox Homology domain of PX-RICS Back     alignment and domain information
>PF10455 BAR_2: Bin/amphiphysin/Rvs domain for vesicular trafficking; InterPro: IPR018859 Endocytosis and intracellular transport involve several mechanistic steps: (1) for the internalisation of cargo molecules, the membrane needs to bend to form a vesicular structure, which requires membrane curvature and a rearrangement of the cytoskeleton; (2) following its formation, the vesicle has to be pinched off the membrane; (3) the cargo has to be subsequently transported through the cell and the vesicle must fuse with the correct cellular compartment Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins Back     alignment and domain information
>cd07648 F-BAR_FCHO The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only proteins Back     alignment and domain information
>KOG3876|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>cd07674 F-BAR_FCHO1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only 1 protein Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>cd07661 BAR_ICA69 The Bin/Amphiphysin/Rvs (BAR) domain of Islet Cell Autoantigen 69-kDa Back     alignment and domain information
>PF09325 Vps5: Vps5 C terminal like; InterPro: IPR015404 Vps5 is a sorting nexin that functions in membrane trafficking Back     alignment and domain information
>cd07596 BAR_SNX The Bin/Amphiphysin/Rvs (BAR) domain of Sorting Nexins Back     alignment and domain information
>cd07299 PX_TCGAP The phosphoinositide binding Phox Homology domain of Tc10/Cdc42 GTPase-activating protein Back     alignment and domain information
>KOG0905|consensus Back     alignment and domain information
>cd07676 F-BAR_FBP17 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Formin Binding Protein 17 Back     alignment and domain information
>cd07650 F-BAR_Syp1p_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of yeast Syp1 protein Back     alignment and domain information
>cd07680 F-BAR_PACSIN1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) Back     alignment and domain information
>cd07681 F-BAR_PACSIN3 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3) Back     alignment and domain information
>cd07643 I-BAR_IMD_MIM Inverse (I)-BAR, also known as the IRSp53/MIM homology Domain (IMD), of Missing In Metastasis Back     alignment and domain information
>cd07278 PX_RICS_like The phosphoinositide binding Phox Homology domain of PX-RICS-like proteins Back     alignment and domain information
>cd07672 F-BAR_PSTPIP2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 2 Back     alignment and domain information
>cd07679 F-BAR_PACSIN2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons 2 (PACSIN2) Back     alignment and domain information
>cd07673 F-BAR_FCHO2 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of FCH domain Only 2 protein Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>cd07686 F-BAR_Fer The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fer (Fes related) tyrosine kinase Back     alignment and domain information
>cd07647 F-BAR_PSTPIP The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Proteins Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>COG5391 Phox homology (PX) domain protein [Intracellular trafficking and secretion / General function prediction only] Back     alignment and domain information
>cd07657 F-BAR_Fes_Fer The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Fes (feline sarcoma) and Fer (Fes related) tyrosine kinases Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>cd07651 F-BAR_PombeCdc15_like The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Schizosaccharomyces pombe Cdc15, and similar proteins Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>cd07671 F-BAR_PSTPIP1 The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>KOG2273|consensus Back     alignment and domain information
>PRK11546 zraP zinc resistance protein; Provisional Back     alignment and domain information
>cd07610 FCH_F-BAR The Extended FES-CIP4 Homology (FCH) or F-BAR (FCH and Bin/Amphiphysin/Rvs) domain, a dimerization module that binds and bends membranes Back     alignment and domain information
>cd07307 BAR The Bin/Amphiphysin/Rvs (BAR) domain, a dimerization module that binds membranes and detects membrane curvature Back     alignment and domain information
>PF04048 Sec8_exocyst: Sec8 exocyst complex component specific domain; InterPro: IPR007191 Sec8 is a component of the exocyst complex involved in the docking of exocystic vesicles with a fusion site on the plasma membrane Back     alignment and domain information
>cd07598 BAR_FAM92 The Bin/Amphiphysin/Rvs (BAR) domain of Family with sequence similarity 92 (FAM92) Back     alignment and domain information
>cd07655 F-BAR_PACSIN The F-BAR (FES-CIP4 Homology and Bin/Amphiphysin/Rvs) domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>cd07627 BAR_Vps5p The Bin/Amphiphysin/Rvs (BAR) domain of yeast Sorting Nexin Vps5p Back     alignment and domain information
>PF15642 Tox-ODYAM1: Toxin in Odyssella and Amoebophilus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
3iq2_A138 Human Sorting Nexin 7, Phox Homology (Px) Domain Le 3e-17
2csk_A146 Solution Structure Of Px Domain From Human Snx12 Le 5e-06
4akv_A386 Crystal Structure Of Human Sorting Nexin 33 (Snx33) 1e-05
3dyu_A366 Crystal Structure Of Snx9px-Bar (230-595), H32 Leng 2e-05
2raj_A392 So4 Bound Px-Bar Membrane Remodeling Unit Of Sortin 2e-05
3hpc_X161 Crystal Structure Of Snx5-Px Domain In P21 Space Gr 4e-05
3hpb_A161 Crystal Structure Of Snx5-Px Domain In P212121 Spac 5e-05
2i4k_A128 Solution Structure Of The Px Domain Of Sorting Nexi 5e-05
1ocs_A162 Crystal Structure Of The Yeast Px-Doamin Protein Gr 1e-04
3dyt_A366 Crystal Structure Of Snx9px-Bar (230-595), C2221 Le 5e-04
2rai_A392 The Px-Bar Membrane Remodeling Unit Of Sorting Nexi 7e-04
>pdb|3IQ2|A Chain A, Human Sorting Nexin 7, Phox Homology (Px) Domain Length = 138 Back     alignment and structure

Iteration: 1

Score = 85.9 bits (211), Expect = 3e-17, Method: Compositional matrix adjust. Identities = 44/91 (48%), Positives = 56/91 (61%) Query: 2 EFPDTECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSLLEHLNRYSKEFILCRMKLL 61 EF +E VRRRY DF+WL KL E P+ IIPPLPEK + + R++ +FI R K L Sbjct: 39 EFDSSEFEVRRRYQDFLWLKGKLEEAHPTLIIPPLPEKFIVKGMVERFNDDFIETRRKAL 98 Query: 62 DQFLRRVTSHPVLSVNSHAIIFLTAKLAEFS 92 +FL R+ HP L+ N IFLTA+ E S Sbjct: 99 HKFLNRIADHPTLTFNEDFKIFLTAQAWELS 129
>pdb|2CSK|A Chain A, Solution Structure Of Px Domain From Human Snx12 Length = 146 Back     alignment and structure
>pdb|4AKV|A Chain A, Crystal Structure Of Human Sorting Nexin 33 (Snx33) Length = 386 Back     alignment and structure
>pdb|3DYU|A Chain A, Crystal Structure Of Snx9px-Bar (230-595), H32 Length = 366 Back     alignment and structure
>pdb|2RAJ|A Chain A, So4 Bound Px-Bar Membrane Remodeling Unit Of Sorting Nexin 9 Length = 392 Back     alignment and structure
>pdb|3HPC|X Chain X, Crystal Structure Of Snx5-Px Domain In P21 Space Group Length = 161 Back     alignment and structure
>pdb|3HPB|A Chain A, Crystal Structure Of Snx5-Px Domain In P212121 Space Group Length = 161 Back     alignment and structure
>pdb|2I4K|A Chain A, Solution Structure Of The Px Domain Of Sorting Nexin 1 Length = 128 Back     alignment and structure
>pdb|1OCS|A Chain A, Crystal Structure Of The Yeast Px-Doamin Protein Grd19p (Sorting Nexin3) Complexed To Phosphatidylinosytol-3-Phosphate. Length = 162 Back     alignment and structure
>pdb|3DYT|A Chain A, Crystal Structure Of Snx9px-Bar (230-595), C2221 Length = 366 Back     alignment and structure
>pdb|2RAI|A Chain A, The Px-Bar Membrane Remodeling Unit Of Sorting Nexin 9 Length = 392 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
3dyt_A366 Sorting nexin-9; 3-helix bundle, BAR domain, PX do 2e-38
4akv_A386 Sorting nexin-33; transport protein, organelle bio 3e-38
3iq2_A138 Sorting nexin-7; SNX7, PHOX, protein signalling, S 2e-30
2csk_A146 Sorting nexin 12; SNX12, PX domain, structural gen 6e-26
2i4k_A128 Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 al 3e-23
1ocs_A162 Sorting nexin GRD19; sorting protein, PX-domain, y 4e-23
3lui_A115 Sorting nexin-17, SNX17; PX domain, endosome, phos 2e-21
1xte_A154 Serine/threonine-protein kinase SGK3; CISK, PX dom 3e-20
3hpc_X161 SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosph 4e-15
1kmd_A117 VAM7P, vacuolar morphogenesis protein VAM7; PX dom 9e-15
2v14_A134 Kinesin-like motor protein C20ORF23; plus-END kine 1e-14
3p0c_A130 Nischarin; structural genomics, structural genomic 1e-14
2ett_A128 Sorting nexin-22; PX domain, BC019655, SNX22_human 1e-10
2ar5_A121 Phosphoinositide 3-kinase; PX domain, transferase; 2e-10
2iwl_X140 Phosphatidylinositol-4-phosphate 3-kinase C2 domai 3e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
2l73_A149 NADPH oxidase organizer 1; cell membrane, PX domai 9e-09
1h6h_A143 Neutrophil cytosol factor 4; PX domain; HET: PIB; 1e-08
1kq6_A141 NCF-1, P47PHOX, neutrophil cytosol factor 1; alpha 1e-07
2wwe_A127 Phosphoinositide-3-kinase, class 2, gamma polypept 8e-07
2v6v_A156 BUD emergence protein 1; homotypic fusion, regulat 5e-05
>3dyt_A Sorting nexin-9; 3-helix bundle, BAR domain, PX domain, phosphoprotein, protein transport, SH3 domain, transport, transport protein; 2.08A {Homo sapiens} PDB: 3dyu_A 2raj_A 2rai_A 2rak_A* Length = 366 Back     alignment and structure
 Score =  139 bits (352), Expect = 2e-38
 Identities = 55/357 (15%), Positives = 113/357 (31%), Gaps = 69/357 (19%)

Query: 6   TECIVRRRYNDFVWLHNKLVETLPSHI-IPPLPEKHSLLEHLNRYSKEFILCRMKLLDQF 64
           T   V  RY  F WL+ +L+    S I IP LP+K        R+ +EFI  RM+ L  +
Sbjct: 50  TNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVT----GRFEEEFIKMRMERLQAW 105

Query: 65  LRRVTSHPVLSVNSHAIIFLTAKLAEFSMHKKHSPGLLNKMSESFYNLTNI-YTTMSLRH 123
           + R+  HPV+S +     FL  +  +     K             ++        + L  
Sbjct: 106 MTRMCRHPVISESEVFQQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVE 165

Query: 124 HHSEFEQFSQYISNLYEKISAFEKIGTRLYKERKDYVSEAHQ--------FAIVLNTWAG 175
              + E   ++   + + +     +G   +K     + + +Q         A V ++   
Sbjct: 166 IEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGY 225

Query: 176 YEPQ-LSSVIRQVSKAVDTTASL---HKNLLIEPFHEHNSHPMKDYLMYIDAVKQVLARR 231
                L+  I +  K  +  ASL        +    E       +Y  ++     ++   
Sbjct: 226 QGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLME----CNHEYKGFLGCFPDIIGTH 281

Query: 232 DVIQAEHDMCGEELQKKTAEKEQLTNKDSDSSSPTSSTATSSTNSYSLWKSTSEDRLEKL 291
                          K   EK +                                  +KL
Sbjct: 282 ---------------KGAIEKVK--------------------------------ESDKL 294

Query: 292 STAIPKLTSQLEICDEKLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYYQQ 348
                      +   +++   +  L++++  +   +  D   ++    +QQ+ +Y+ 
Sbjct: 295 VATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYET 351


>4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} Length = 386 Back     alignment and structure
>3iq2_A Sorting nexin-7; SNX7, PHOX, protein signalling, SGC, structur genomics consortium, protein transport, transport; 1.70A {Homo sapiens} Length = 138 Back     alignment and structure
>2csk_A Sorting nexin 12; SNX12, PX domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 146 Back     alignment and structure
>2i4k_A Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 alpha helices, proline rich loop, protein transport; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1ocs_A Sorting nexin GRD19; sorting protein, PX-domain, yeast protein; HET: CME; 2.03A {Saccharomyces cerevisiae} SCOP: d.189.1.1 PDB: 1ocu_A* Length = 162 Back     alignment and structure
>3lui_A Sorting nexin-17, SNX17; PX domain, endosome, phosphoprotein, P transport, transport; 1.80A {Homo sapiens} PDB: 3fog_A Length = 115 Back     alignment and structure
>1xte_A Serine/threonine-protein kinase SGK3; CISK, PX domain, transferase; 1.60A {Mus musculus} SCOP: d.189.1.1 PDB: 1xtn_A Length = 154 Back     alignment and structure
>3hpc_X SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosphatidylinositol, PI(4,5)P2, cell adhesion, protein transport; 1.47A {Rattus norvegicus} PDB: 3hpb_A Length = 161 Back     alignment and structure
>1kmd_A VAM7P, vacuolar morphogenesis protein VAM7; PX domain, phosphoinositide binding, endocytosis/exocytosis complex; NMR {Saccharomyces cerevisiae} SCOP: d.189.1.1 Length = 117 Back     alignment and structure
>2v14_A Kinesin-like motor protein C20ORF23; plus-END kinesin complex, transport protein, phosphatidylinositol 3-phosphate binding, nucleotide-binding; 2.20A {Homo sapiens} Length = 134 Back     alignment and structure
>3p0c_A Nischarin; structural genomics, structural genomics consortium, SGC, PX signaling protein; 2.27A {Homo sapiens} Length = 130 Back     alignment and structure
>2ett_A Sorting nexin-22; PX domain, BC019655, SNX22_human, HS.157607, structural genomics,protein structure initiative PSI; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>2ar5_A Phosphoinositide 3-kinase; PX domain, transferase; 1.80A {Homo sapiens} PDB: 2rea_A 2red_A Length = 121 Back     alignment and structure
>2iwl_X Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide; PI3K, PX domain, transferase; 2.6A {Homo sapiens} Length = 140 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2l73_A NADPH oxidase organizer 1; cell membrane, PX domain, oxidoreductase regulator; NMR {Homo sapiens} Length = 149 Back     alignment and structure
>1h6h_A Neutrophil cytosol factor 4; PX domain; HET: PIB; 1.7A {Homo sapiens} SCOP: d.189.1.1 Length = 143 Back     alignment and structure
>1kq6_A NCF-1, P47PHOX, neutrophil cytosol factor 1; alpha beta, PX domain, NADPH oxidase, protein binding; HET: MSE; 1.18A {Homo sapiens} SCOP: d.189.1.1 PDB: 1gd5_A 1o7k_A Length = 141 Back     alignment and structure
>2wwe_A Phosphoinositide-3-kinase, class 2, gamma polypeptide; phosphoprotein, nucleotide-binding, PIK3C2G, membrane, PX-domain, transferase, ATP-binding; 1.25A {Homo sapiens} Length = 127 Back     alignment and structure
>2v6v_A BUD emergence protein 1; homotypic fusion, regulator, PI3P, 3-kinase, PX domain, SH3 domain, cytoskeleton, cell polarity; 1.5A {Saccharomyces cerevisiae} PDB: 2czo_A Length = 156 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query357
3dyt_A366 Sorting nexin-9; 3-helix bundle, BAR domain, PX do 100.0
4akv_A386 Sorting nexin-33; transport protein, organelle bio 100.0
3hpc_X161 SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosph 99.92
3iq2_A138 Sorting nexin-7; SNX7, PHOX, protein signalling, S 99.92
1ocs_A162 Sorting nexin GRD19; sorting protein, PX-domain, y 99.89
2i4k_A128 Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 al 99.88
2csk_A146 Sorting nexin 12; SNX12, PX domain, structural gen 99.88
3lui_A115 Sorting nexin-17, SNX17; PX domain, endosome, phos 99.86
3p0c_A130 Nischarin; structural genomics, structural genomic 99.82
1kmd_A117 VAM7P, vacuolar morphogenesis protein VAM7; PX dom 99.82
1xte_A154 Serine/threonine-protein kinase SGK3; CISK, PX dom 99.8
1h6h_A143 Neutrophil cytosol factor 4; PX domain; HET: PIB; 99.77
2v14_A134 Kinesin-like motor protein C20ORF23; plus-END kine 99.77
2ett_A128 Sorting nexin-22; PX domain, BC019655, SNX22_human 99.76
2ar5_A121 Phosphoinositide 3-kinase; PX domain, transferase; 99.76
4az9_A129 Sorting nexin-24; protein transport; 1.75A {Homo s 99.72
1kq6_A141 NCF-1, P47PHOX, neutrophil cytosol factor 1; alpha 99.71
2iwl_X140 Phosphatidylinositol-4-phosphate 3-kinase C2 domai 99.7
2v6v_A156 BUD emergence protein 1; homotypic fusion, regulat 99.63
2fic_A251 Bridging integrator 1; BAR domain, homodimer, coil 99.59
1uru_A244 Amphiphysin; endocytosis, coiled-coil, membrane cu 99.54
2l73_A149 NADPH oxidase organizer 1; cell membrane, PX domai 99.54
2wwe_A127 Phosphoinositide-3-kinase, class 2, gamma polypept 99.36
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 99.24
4avm_A237 Bridging integrator 2; protein binding, plasma mem 99.23
4a3a_A243 Amphiphysin; structural genomics, invagination, kn 99.14
1zww_A256 SH3-containing GRB2-like protein 2; coiled coil, t 98.79
2z0v_A240 SH3-containing GRB2-like protein 3; helix bundle, 98.6
2q12_A265 DIP13 alpha, DCC-interacting protein 13 alpha; APP 98.55
2q13_A 385 DCC-interacting protein 13 alpha; APPL1, BAR domai 98.42
1i4d_A224 Arfaptin 2, partner of RAC1; coiled coil, G-protei 98.32
4h8s_A 407 DCC-interacting protein 13-beta; BAR domain, pleck 97.85
2ykt_A253 Brain-specific angiogenesis inhibitor 1-associate 97.39
3plt_A234 Sphingolipid long chain base-responsive protein L; 97.04
2d1l_A253 Metastasis suppressor protein 1; IRSP53, actin bin 97.0
3haj_A 486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 96.97
4dyl_A 406 Tyrosine-protein kinase FES/FPS; structural genomi 96.65
2v0o_A276 FCHO2, FCH domain only protein 2; lipid-binding pr 96.61
2efl_A305 Formin-binding protein 1; EFC domain, structural g 96.61
3abh_A312 Pacsin2, protein kinase C and casein kinase substr 96.51
3aco_A350 Pacsin2, protein kinase C and casein kinase substr 96.5
2efk_A301 CDC42-interacting protein 4; EFC domain, structura 96.41
3i2w_A290 Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocyt 96.13
2x3v_A337 Syndapin I, protein kinase C and casein kinase sub 95.96
3ok8_A222 Brain-specific angiogenesis inhibitor 1-associate 95.34
3m3w_A320 Pacsin3, protein kinase C and casein kinase II sub 94.35
3g9g_A287 Suppressor of yeast profilin deletion; SYP1, BAR d 93.77
3iv1_A78 Tumor susceptibility gene 101 protein; coiled_COIL 80.17
>3dyt_A Sorting nexin-9; 3-helix bundle, BAR domain, PX domain, phosphoprotein, protein transport, SH3 domain, transport, transport protein; 2.08A {Homo sapiens} PDB: 3dyu_A 2raj_A 2rai_A 2rak_A* Back     alignment and structure
Probab=100.00  E-value=2.3e-45  Score=347.20  Aligned_cols=291  Identities=18%  Similarity=0.296  Sum_probs=228.4

Q ss_pred             CcceeecchhhHHHHHHHHHHhCCC-CCCCCCCCccccchhhhcCCHHHHHHHHHHHHHHHHHHHcCccccCChhhhccc
Q psy18202          6 TECIVRRRYNDFVWLHNKLVETLPS-HIIPPLPEKHSLLEHLNRYSKEFILCRMKLLDQFLRRVTSHPVLSVNSHAIIFL   84 (357)
Q Consensus         6 ~~~~V~RRysdF~~L~~~L~~~~p~-~~iPplP~K~~~~~~~~~~~~~fie~R~~~L~~fL~~i~~hp~L~~~~~~~~FL   84 (357)
                      ++|.|+||||||.|||+.|...||+ ++|||||+|..+    ++++++||++||++|++||++|+.||+|++|+.|+.||
T Consensus        50 ~~~~V~RRYsdF~~L~~~L~~~~p~~~~iP~lP~K~~~----g~~~~~fie~Rr~~Le~fL~~i~~~p~l~~~~~~~~FL  125 (366)
T 3dyt_A           50 TNRSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVT----GRFEEEFIKMRMERLQAWMTRMCRHPVISESEVFQQFL  125 (366)
T ss_dssp             CSCCEEEEHHHHHHHHHHHHHHHTTTSCCCCCC---------------CHHHHHHHHHHHHHHHHTCTTGGGSHHHHHHH
T ss_pred             CcEEEEeeHHHHHHHHHHHHHhCCCcCcCCCCcCCccc----CCCCHHHHHHHHHHHHHHHHHHhCCHhhhCCcHHHHhh
Confidence            4789999999999999999999999 999999999987    77899999999999999999999999999999999999


Q ss_pred             ccccc-chhhccc-------CCCCccccchhhhhhhhhhhccccccCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHh-
Q psy18202         85 TAKLA-EFSMHKK-------HSPGLLNKMSESFYNLTNIYTTMSLRHHHSEFEQFSQYISNLYEKISAFEKIGTRLYKE-  155 (357)
Q Consensus        85 ~~~~~-~~~~~~k-------~~~~~~~~~~~~~~~~~~~~~~~~~~e~d~~f~~~~~~~~~l~~~l~~l~~~~~~l~k~-  155 (357)
                      +.++. .|....+       .|+++++.+..    +..   ...+.+.+++|+.++.|+..++..++.+.+.+.+++++ 
T Consensus       126 ~~~~~~~w~~~~r~~~~~~~~g~~~~~~~~~----~~~---~~~~~~~~~~~~~~~~~~~~l~~~~~~l~~~~~~~~~~~  198 (366)
T 3dyt_A          126 NFRDEKEWKTGKRKAERDELAGVMIFSTMEP----EAP---DLDLVEIEQKCEAVGKFTKAMDDGVKELLTVGQEHWKRC  198 (366)
T ss_dssp             HCSSHHHHHHHHHHHHTCCCCGGGGGGGEEE----SSC---CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCchhhHHHHhhhhccCcccchHHHHHhcC----CCC---CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            98752 2432211       23444433321    111   11245567889999999999999999999999999877 


Q ss_pred             hHHHHHHHHHHHHHHHHhhCC------c--hhHHHHHHHHHHHHHHHHHHHHHHhhhhhhhhcchhHHHHHHHHHHHHHH
Q psy18202        156 RKDYVSEAHQFAIVLNTWAGY------E--PQLSSVIRQVSKAVDTTASLHKNLLIEPFHEHNSHPMKDYLMYIDAVKQV  227 (357)
Q Consensus       156 ~~~l~~~~~~~~~~~~~l~~~------E--~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~a~k~~  227 (357)
                      ..+++.++..+|.+|..||.+      +  ++|+.++..+|++++.++++..+ ++......|+++|++|.+++.++|++
T Consensus       199 ~~~~~~~~~~l~~~l~~l~~~~~~~~~~~~~~L~~al~~l~~~~~~i~~l~~~-qa~~d~~~l~E~L~~Y~~~l~avKd~  277 (366)
T 3dyt_A          199 TGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAE-QPKKDLHFLMECNHEYKGFLGCFPDI  277 (366)
T ss_dssp             HTHHHHHHHHHHHHHHHHHHHHHTTCCGGGHHHHHHHHHHHHHHHHHHHHHHH-SGGGTHHHHHHHHHHHHHHHTTHHHH
T ss_pred             HhHHHHHHHHHHHHHHHHHHHHhhccccccHHHHHHHHHHHHHHHHHHHHHHH-HHHHhHHHHHHHHHHHHHHHHHHHHH
Confidence            467777888888888887752      2  34999999999999999999888 67666779999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCCCCCCCCCcccCCCcccccCCccHHHHHHHHhhHhHHHHHHHHHHH
Q psy18202        228 LARRDVIQAEHDMCGEELQKKTAEKEQLTNKDSDSSSPTSSTATSSTNSYSLWKSTSEDRLEKLSTAIPKLTSQLEICDE  307 (357)
Q Consensus       228 l~~R~~~~~~~~~~~~~l~kk~~~~~kL~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~ki~~l~~~i~~le~~~~~~~~  307 (357)
                      |.+|..++..+..+.           ++...  ++.                    +.              .+++.++.
T Consensus       278 l~~r~~aL~k~~e~~-----------kl~~~--~K~--------------------~~--------------~~~~~~~~  310 (366)
T 3dyt_A          278 IGTHKGAIEKVKESD-----------KLVAT--SKI--------------------TL--------------QDKQNMVK  310 (366)
T ss_dssp             HHHHHHHHHHHHTHH-----------HHHHT--TSS--------------------CH--------------HHHHHHHH
T ss_pred             HHHHHHHHHHHHHHH-----------HHHhc--cCc--------------------ch--------------hHHHHHHH
Confidence            999998766555432           22222  110                    01              13566778


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccc
Q psy18202        308 KLQTANNHLRSDLERWRLEKKNDLKKILLKIADQQIAYYQQRSDRGNC  355 (357)
Q Consensus       308 ~~~~i~~~~~~El~rF~~~k~~~l~~~l~~~a~~qi~~~~~~~~~W~~  355 (357)
                      +++.|+..++.|+.||+.+|..||+.+|.+|++.||.+|++.++.|+.
T Consensus       311 r~e~is~~~~~El~rF~~~r~~Dfk~~l~~yl~~qi~~~k~~~~~w~~  358 (366)
T 3dyt_A          311 RVSIMSYALQAEMNHFHSNRIYDYNSVIRLYLEQQVQFYETIAEKLRQ  358 (366)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999999964



>4akv_A Sorting nexin-33; transport protein, organelle biogenesis; 2.65A {Homo sapiens} Back     alignment and structure
>3hpc_X SNX5 protein; sprting nexin, PHOX, SNX5-PX, phosphatidylinositol, PI(4,5)P2, cell adhesion, protein transport; 1.47A {Rattus norvegicus} PDB: 3hpb_A Back     alignment and structure
>3iq2_A Sorting nexin-7; SNX7, PHOX, protein signalling, SGC, structur genomics consortium, protein transport, transport; 1.70A {Homo sapiens} Back     alignment and structure
>1ocs_A Sorting nexin GRD19; sorting protein, PX-domain, yeast protein; HET: CME; 2.03A {Saccharomyces cerevisiae} SCOP: d.189.1.1 PDB: 1ocu_A* Back     alignment and structure
>2i4k_A Sorting nexin-1, SNX1; 3-stranded beta sheet, 3 alpha helices, proline rich loop, protein transport; NMR {Homo sapiens} Back     alignment and structure
>2csk_A Sorting nexin 12; SNX12, PX domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lui_A Sorting nexin-17, SNX17; PX domain, endosome, phosphoprotein, P transport, transport; 1.80A {Homo sapiens} PDB: 3fog_A Back     alignment and structure
>3p0c_A Nischarin; structural genomics, structural genomics consortium, SGC, PX signaling protein; 2.27A {Homo sapiens} Back     alignment and structure
>1kmd_A VAM7P, vacuolar morphogenesis protein VAM7; PX domain, phosphoinositide binding, endocytosis/exocytosis complex; NMR {Saccharomyces cerevisiae} SCOP: d.189.1.1 Back     alignment and structure
>1xte_A Serine/threonine-protein kinase SGK3; CISK, PX domain, transferase; 1.60A {Mus musculus} SCOP: d.189.1.1 PDB: 1xtn_A Back     alignment and structure
>1h6h_A Neutrophil cytosol factor 4; PX domain; HET: PIB; 1.7A {Homo sapiens} SCOP: d.189.1.1 Back     alignment and structure
>2v14_A Kinesin-like motor protein C20ORF23; plus-END kinesin complex, transport protein, phosphatidylinositol 3-phosphate binding, nucleotide-binding; 2.20A {Homo sapiens} Back     alignment and structure
>2ett_A Sorting nexin-22; PX domain, BC019655, SNX22_human, HS.157607, structural genomics,protein structure initiative PSI; NMR {Homo sapiens} Back     alignment and structure
>2ar5_A Phosphoinositide 3-kinase; PX domain, transferase; 1.80A {Homo sapiens} PDB: 2rea_A 2red_A Back     alignment and structure
>4az9_A Sorting nexin-24; protein transport; 1.75A {Homo sapiens} Back     alignment and structure
>1kq6_A NCF-1, P47PHOX, neutrophil cytosol factor 1; alpha beta, PX domain, NADPH oxidase, protein binding; HET: MSE; 1.18A {Homo sapiens} SCOP: d.189.1.1 PDB: 1gd5_A 1o7k_A Back     alignment and structure
>2iwl_X Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containing alpha polypeptide; PI3K, PX domain, transferase; 2.6A {Homo sapiens} Back     alignment and structure
>2v6v_A BUD emergence protein 1; homotypic fusion, regulator, PI3P, 3-kinase, PX domain, SH3 domain, cytoskeleton, cell polarity; 1.5A {Saccharomyces cerevisiae} PDB: 2czo_A Back     alignment and structure
>2fic_A Bridging integrator 1; BAR domain, homodimer, coiled-coils, endocytosis/exocytosis, protein complex, endocytosis-exocytosis; 1.99A {Homo sapiens} PDB: 2rmy_A 2rnd_A Back     alignment and structure
>1uru_A Amphiphysin; endocytosis, coiled-coil, membrane curvature; 2.6A {Drosophila melanogaster} SCOP: a.238.1.1 Back     alignment and structure
>2l73_A NADPH oxidase organizer 1; cell membrane, PX domain, oxidoreductase regulator; NMR {Homo sapiens} Back     alignment and structure
>2wwe_A Phosphoinositide-3-kinase, class 2, gamma polypeptide; phosphoprotein, nucleotide-binding, PIK3C2G, membrane, PX-domain, transferase, ATP-binding; 1.25A {Homo sapiens} Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>4avm_A Bridging integrator 2; protein binding, plasma membrane, BAR adaptor; 1.91A {Homo sapiens} Back     alignment and structure
>1zww_A SH3-containing GRB2-like protein 2; coiled coil, transferase; 2.30A {Mus musculus} SCOP: a.238.1.1 PDB: 1x03_A 2d4c_A 1x04_A 2c08_A Back     alignment and structure
>2z0v_A SH3-containing GRB2-like protein 3; helix bundle, alternative splicing, coiled coil, SH3 domain, endocytosis, structural genomics, NPPSFA; 2.49A {Homo sapiens} Back     alignment and structure
>2q12_A DIP13 alpha, DCC-interacting protein 13 alpha; APPL1, BAR domain, protein transport; 1.79A {Homo sapiens} PDB: 2z0n_A Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>1i4d_A Arfaptin 2, partner of RAC1; coiled coil, G-protein, complex, signaling protein; HET: GDP; 2.50A {Homo sapiens} SCOP: a.238.1.2 PDB: 1i49_A* 1i4l_A* 1i4t_A* Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>2ykt_A Brain-specific angiogenesis inhibitor 1-associate protein 2; signaling protein, NPY motif, binding pocket; 2.11A {Homo sapiens} PDB: 1y2o_A 1wdz_A Back     alignment and structure
>3plt_A Sphingolipid long chain base-responsive protein L; eisosomes, LSP1, PIL1, BAR domain, plasma membrane, SELF-ASS phosphoprotein; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2d1l_A Metastasis suppressor protein 1; IRSP53, actin binding, IMD, protein binding; HET: MSE; 1.85A {Mus musculus} Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>4dyl_A Tyrosine-protein kinase FES/FPS; structural genomics, structural genomics consortium, BCR, CR associated substrate, transferase; 2.18A {Homo sapiens} Back     alignment and structure
>2v0o_A FCHO2, FCH domain only protein 2; lipid-binding protein, EFC domain, vesicle trafficking, membrane curvature, endocytosis, exocytosis, F-BAR domain; 2.30A {Homo sapiens} Back     alignment and structure
>2efl_A Formin-binding protein 1; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.61A {Homo sapiens} SCOP: a.238.1.4 Back     alignment and structure
>3abh_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.00A {Homo sapiens} PDB: 3q0k_A 3lll_A 3hah_A 3qni_A 3hai_A 3q84_A Back     alignment and structure
>3aco_A Pacsin2, protein kinase C and casein kinase substrate in neurons protein 2; helix bundle, coiled-coil, endocytosis; 2.70A {Homo sapiens} Back     alignment and structure
>2efk_A CDC42-interacting protein 4; EFC domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.30A {Homo sapiens} SCOP: a.238.1.4 Back     alignment and structure
>3i2w_A Syndapin, LD46328P; EFC, FBAR, SH3 domain, endocytosis; 2.67A {Drosophila melanogaster} Back     alignment and structure
>2x3v_A Syndapin I, protein kinase C and casein kinase substrate in N protein 1; BAR, N-WAsp, dynamin, pacsin 1, endocytosis; 2.45A {Mus musculus} PDB: 2x3w_A 2x3x_A Back     alignment and structure
>3ok8_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 2; I-BAR, protein binding; 2.25A {Mus musculus} Back     alignment and structure
>3m3w_A Pacsin3, protein kinase C and casein kinase II substrate P; mouse, BAR domain, endocytosis; 2.60A {Mus musculus} PDB: 3syv_A 3qe6_A Back     alignment and structure
>3g9g_A Suppressor of yeast profilin deletion; SYP1, BAR domain, FCH, adaptor, endocytosis, phosphoprotein; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 357
d1ocsa_132 d.189.1.1 (A:) Sorting nexin grd19 {Baker's yeast 7e-16
d1kmda_117 d.189.1.1 (A:) Vam7p {Baker's yeast (Saccharomyces 1e-14
d1kq6a_140 d.189.1.1 (A:) p47phox NADPH oxidase {Human (Homo 3e-12
d1xtea_116 d.189.1.1 (A:) Serine/threonine-protein kinase Sgk 5e-12
d1h6ha_143 d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo 4e-08
d1urua_217 a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila 4e-07
>d1ocsa_ d.189.1.1 (A:) Sorting nexin grd19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 132 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: PX domain
superfamily: PX domain
family: PX domain
domain: Sorting nexin grd19
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 71.3 bits (174), Expect = 7e-16
 Identities = 27/90 (30%), Positives = 44/90 (48%), Gaps = 3/90 (3%)

Query: 1   PEFPDTECIVRRRYNDFVWLHNKLVETLPSHIIPPLPEKHSLLEHL--NRYSKEFILCRM 58
           P F      VRRRY+DF +    L++ +     P +   H   + L  NR+S E I  R 
Sbjct: 40  PSFHKRVSKVRRRYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLSNRFSNEVIEERR 99

Query: 59  KLLDQFLRRVTSHPVLSVNSHA-IIFLTAK 87
           + L+ +++ V  HP+L   S   + F+ A+
Sbjct: 100 QGLNTWMQSVAGHPLLQSGSKVLVRFIEAE 129


>d1kmda_ d.189.1.1 (A:) Vam7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 117 Back     information, alignment and structure
>d1kq6a_ d.189.1.1 (A:) p47phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1xtea_ d.189.1.1 (A:) Serine/threonine-protein kinase Sgk3, Cisk {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 Back     information, alignment and structure
>d1h6ha_ d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 217 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query357
d1ocsa_132 Sorting nexin grd19 {Baker's yeast (Saccharomyces 99.83
d1kmda_117 Vam7p {Baker's yeast (Saccharomyces cerevisiae) [T 99.78
d1xtea_116 Serine/threonine-protein kinase Sgk3, Cisk {Mouse 99.76
d1kq6a_140 p47phox NADPH oxidase {Human (Homo sapiens) [TaxId 99.66
d1i4da_200 Arfaptin, Rac-binding fragment {Human (Homo sapien 99.64
d1h6ha_143 p40phox NADPH oxidase {Human (Homo sapiens) [TaxId 99.64
d1urua_217 Amphiphysin {Fruit fly (Drosophila melanogaster) [ 99.63
d1y2oa1248 BAP2/IRSp53 N-terminal domain {Human (Homo sapiens 98.62
d2d4ca1237 Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.51
d2elba1268 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 98.41
d2efla1288 Formin-binding protein 1, FNBP1 {Human (Homo sapie 97.04
d2efka1279 CDC42-interacting protein 4, CIP4 {Human (Homo sap 96.68
d2efla1288 Formin-binding protein 1, FNBP1 {Human (Homo sapie 93.02
d1i4da_200 Arfaptin, Rac-binding fragment {Human (Homo sapien 87.66
d1y2oa1248 BAP2/IRSp53 N-terminal domain {Human (Homo sapiens 81.43
d2efka1279 CDC42-interacting protein 4, CIP4 {Human (Homo sap 81.1
>d1ocsa_ d.189.1.1 (A:) Sorting nexin grd19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: PX domain
superfamily: PX domain
family: PX domain
domain: Sorting nexin grd19
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.83  E-value=1.7e-21  Score=155.61  Aligned_cols=85  Identities=33%  Similarity=0.584  Sum_probs=75.7

Q ss_pred             CCCCCCcceeecchhhHHHHHHHHHHhCC-----CCCCCCCCCccccchhhhcCCHHHHHHHHHHHHHHHHHHHcCcccc
Q psy18202          1 PEFPDTECIVRRRYNDFVWLHNKLVETLP-----SHIIPPLPEKHSLLEHLNRYSKEFILCRMKLLDQFLRRVTSHPVLS   75 (357)
Q Consensus         1 p~f~~~~~~V~RRysdF~~L~~~L~~~~p-----~~~iPplP~K~~~~~~~~~~~~~fie~R~~~L~~fL~~i~~hp~L~   75 (357)
                      |.|....|.|+||||||.|||+.|...||     ++.+||+|++..+.   ++++++|+++||++||.||++|+.||.|+
T Consensus        40 ~~~~~~~~~V~RRYsdF~~L~~~L~~~~~~~~~~~~~~p~~p~~~~~~---~~~~~~~ie~Rr~~Le~fL~~l~~~p~l~  116 (132)
T d1ocsa_          40 PSFHKRVSKVRRRYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILLS---NRFSNEVIEERRQGLNTWMQSVAGHPLLQ  116 (132)
T ss_dssp             TTCSCSEEEEEEEHHHHHHHHHHHHHHHHHTTCTTCCCCCCTTCCCSS---CTTSHHHHHHHHHHHHHHHHHHHTCHHHH
T ss_pred             CCCCCceEEEEeeHHHHHHHHHHHHHhcccccCcccccCCCccccccc---ccCCHHHHHHHHHHHHHHHHHHHcCHHHH
Confidence            67889999999999999999999998655     66788999888763   56799999999999999999999999998


Q ss_pred             C-Chhhhccccccc
Q psy18202         76 V-NSHAIIFLTAKL   88 (357)
Q Consensus        76 ~-~~~~~~FL~~~~   88 (357)
                      . ++.|+.||+.++
T Consensus       117 ~~s~~l~~FLe~~~  130 (132)
T d1ocsa_         117 SGSKVLVRFIEAEK  130 (132)
T ss_dssp             HHCHHHHHHHHCSS
T ss_pred             hCCHHHHhcCCccc
Confidence            6 688999999875



>d1kmda_ d.189.1.1 (A:) Vam7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xtea_ d.189.1.1 (A:) Serine/threonine-protein kinase Sgk3, Cisk {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kq6a_ d.189.1.1 (A:) p47phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ha_ d.189.1.1 (A:) p40phox NADPH oxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1urua_ a.238.1.1 (A:) Amphiphysin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d4ca1 a.238.1.1 (A:11-247) Endophilin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba1 a.238.1.1 (A:6-273) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2efla1 a.238.1.4 (A:1-288) Formin-binding protein 1, FNBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i4da_ a.238.1.2 (A:) Arfaptin, Rac-binding fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2efka1 a.238.1.4 (A:10-288) CDC42-interacting protein 4, CIP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure