Diaphorina citri psyllid: psy18225

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------

TGYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQQGLTDELNRLYSMFVARNPNHNAKISIIAHSLGCVIVYDVITGWIP

cccccccccccccccccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHccccc

*GYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQQGLTDELNRLYSMFVARNPNHNAKISIIAHSLGCVIVYDVITGWI*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

TGYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQQGLTDELNRLYSMFVARNPNHNAKISIIAHSLGCVIVYDVITGWIP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Phospholipase DDHD1	Probable phospholipase that hydrolyzes phosphatidic acid. The different isoforms may change the substrate specificity.	confident	Q80YA3
Phospholipase DDHD1	Phospholipase that hydrolyzes phosphatidic acid.	confident	O46606
Phospholipase DDHD1	Probable phospholipase that hydrolyzes phosphatidic acid. The different isoforms may change the substrate specificity.	confident	Q8NEL9

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043231 [CC]	intracellular membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044444 [CC]	cytoplasmic part	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PBL, chain A
Confidence level:probable
Coverage over the Query: 122-164
View the alignment between query and template
View the model in PyMOL