Psyllid ID: psy18225


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
TGYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQQGLTDELNRLYSMFVARNPNHNAKISIIAHSLGCVIVYDVITGWIP
cccccccccccccccccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHccccc
cccEEccccccccccccccccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHccccc
tgyrlargykdqaletdrpediSHLVFVVHGmgqkmdsgrIIKNATQFRESVMWLKKKYFASSklraeffpvewrsslaldgdiveSITQLNVLNLRHMLNASAMDImyytspiygseiQQGLTDELNRLYSMFVarnpnhnaKISIIAHSLGCVIVYDVITGWIP
tgyrlargykdqaletdrpediSHLVFVVHGmgqkmdsgRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQQGLTDELNRLYSMFVARNPNHNAKISIIAHSLGCVIVYDVITGWIP
TGYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQQGLTDELNRLYSMFVARNPNHNAKISIIAHSLGCVIVYDVITGWIP
*********************ISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQQGLTDELNRLYSMFVARNPNHNAKISIIAHSLGCVIVYDVITGWI*
*GYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQQGLTDELNRLYSMFVARNPNHNAKISIIAHSLGCVIVYDVITGWI*
TGYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQQGLTDELNRLYSMFVARNPNHNAKISIIAHSLGCVIVYDVITGWIP
*****ARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQQGLTDELNRLYSMFVARNPNHNAKISIIAHSLGCVIVYDVITGWI*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TGYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQQGLTDELNRLYSMFVARNPNHNAKISIIAHSLGCVIVYDVITGWIP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query166 2.2.26 [Sep-21-2011]
O46606 875 Phospholipase DDHD1 OS=Bo yes N/A 1.0 0.189 0.568 9e-54
Q80YA3 547 Phospholipase DDHD1 OS=Mu yes N/A 1.0 0.303 0.568 2e-53
Q8NEL9 900 Phospholipase DDHD1 OS=Ho yes N/A 1.0 0.184 0.562 3e-53
Q80Y98 699 Phospholipase DDHD2 OS=Mu no N/A 0.867 0.206 0.372 2e-22
O94830 711 Phospholipase DDHD2 OS=Ho no N/A 0.873 0.203 0.363 3e-22
Q6NZC7 998 SEC23-interacting protein no N/A 0.903 0.150 0.353 3e-21
Q9Y6Y8 1000 SEC23-interacting protein no N/A 0.909 0.151 0.349 2e-20
Q12204 715 Probable phospholipase YO yes N/A 0.909 0.211 0.288 1e-14
P87109 757 Probable phospholipase C2 yes N/A 0.849 0.186 0.25 6e-12
Q7LKZ6 669 Probable phospholipase C1 no N/A 0.849 0.210 0.235 3e-07
>sp|O46606|DDHD1_BOVIN Phospholipase DDHD1 OS=Bos taurus GN=DDHD1 PE=1 SV=1 Back     alignment and function desciption
 Score =  209 bits (531), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 96/169 (56%), Positives = 123/169 (72%), Gaps = 3/169 (1%)

Query: 1   TGYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYF 60
           +G RL RGY ++A   D+P   +H+VFVVHG+GQKMD GRIIKN    RE+   +++++F
Sbjct: 387 SGTRLHRGYVEEATLEDKPSQTTHIVFVVHGIGQKMDQGRIIKNTAMMREAARKIEERHF 446

Query: 61  ASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQ 120
           ++     EF PVEWRS L LDGD V+SIT   V  LR MLN+SAMDIMYYTSP+Y  E+ 
Sbjct: 447 SNHATHVEFLPVEWRSKLTLDGDTVDSITPDKVRGLRDMLNSSAMDIMYYTSPLYRDELV 506

Query: 121 QGLTDELNRLYSMFVARNPN---HNAKISIIAHSLGCVIVYDVITGWIP 166
           +GL  ELNRLYS+F +RNPN      K+SI++HSLGCVI YD++TGW P
Sbjct: 507 KGLQQELNRLYSLFCSRNPNFEEKGGKVSIVSHSLGCVITYDIMTGWNP 555




Phospholipase that hydrolyzes phosphatidic acid.
Bos taurus (taxid: 9913)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q80YA3|DDHD1_MOUSE Phospholipase DDHD1 OS=Mus musculus GN=Ddhd1 PE=2 SV=1 Back     alignment and function description
>sp|Q8NEL9|DDHD1_HUMAN Phospholipase DDHD1 OS=Homo sapiens GN=DDHD1 PE=1 SV=2 Back     alignment and function description
>sp|Q80Y98|DDHD2_MOUSE Phospholipase DDHD2 OS=Mus musculus GN=Ddhd2 PE=1 SV=3 Back     alignment and function description
>sp|O94830|DDHD2_HUMAN Phospholipase DDHD2 OS=Homo sapiens GN=DDHD2 PE=1 SV=2 Back     alignment and function description
>sp|Q6NZC7|S23IP_MOUSE SEC23-interacting protein OS=Mus musculus GN=Sec23ip PE=1 SV=2 Back     alignment and function description
>sp|Q9Y6Y8|S23IP_HUMAN SEC23-interacting protein OS=Homo sapiens GN=SEC23IP PE=1 SV=1 Back     alignment and function description
>sp|Q12204|YOR22_YEAST Probable phospholipase YOR022C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR022C PE=1 SV=1 Back     alignment and function description
>sp|P87109|YDK2_SCHPO Probable phospholipase C20G8.02, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20G8.02 PE=3 SV=1 Back     alignment and function description
>sp|Q7LKZ6|YJMD_SCHPO Probable phospholipase C1020.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1020.13c PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
332023936 616 Phospholipase DDHD1 [Acromyrmex echinati 0.993 0.267 0.666 5e-63
383850969 602 PREDICTED: phospholipase DDHD1-like [Meg 0.993 0.274 0.654 3e-62
307206698 610 Phospholipase DDHD1 [Harpegnathos saltat 0.993 0.270 0.660 7e-62
110748986 601 PREDICTED: phospholipase DDHD1-like [Api 0.993 0.274 0.636 3e-61
350414488 602 PREDICTED: phospholipase DDHD1-like [Bom 0.993 0.274 0.636 5e-61
340715461 602 PREDICTED: phospholipase DDHD1-like [Bom 0.993 0.274 0.636 5e-61
242014961 1219 phospholipase ddhd1, putative [Pediculus 0.987 0.134 0.666 1e-60
345492992 681 PREDICTED: phospholipase DDHD1-like [Nas 0.993 0.242 0.636 2e-60
307183315 608 Phospholipase DDHD1 [Camponotus floridan 0.981 0.268 0.642 2e-58
432938315 847 PREDICTED: phospholipase DDHD1-like [Ory 1.0 0.195 0.6 8e-53
>gi|332023936|gb|EGI64154.1| Phospholipase DDHD1 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  245 bits (625), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 110/165 (66%), Positives = 136/165 (82%)

Query: 1   TGYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYF 60
           TGYRL RGYK +    D+P DI HLVFVVHG+GQK D+G+II+N T FR+ V WLK+KYF
Sbjct: 233 TGYRLKRGYKTRTNMEDKPRDIDHLVFVVHGIGQKRDTGKIIRNTTCFRDCVDWLKQKYF 292

Query: 61  ASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQ 120
            +SK R EFFPVEWRSSL LDGDIV++IT  +VL++RH+LN SAMDI+YYTSP+YG+E++
Sbjct: 293 PNSKHRVEFFPVEWRSSLKLDGDIVDAITPYSVLSIRHLLNTSAMDILYYTSPLYGAEVR 352

Query: 121 QGLTDELNRLYSMFVARNPNHNAKISIIAHSLGCVIVYDVITGWI 165
            GL  ELN LY MF +R+P+   KISI+AHSLGCVIVYD++TGWI
Sbjct: 353 AGLQKELNSLYCMFASRHPDWQGKISILAHSLGCVIVYDIVTGWI 397




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383850969|ref|XP_003701036.1| PREDICTED: phospholipase DDHD1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307206698|gb|EFN84653.1| Phospholipase DDHD1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|110748986|ref|XP_001119847.1| PREDICTED: phospholipase DDHD1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350414488|ref|XP_003490333.1| PREDICTED: phospholipase DDHD1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340715461|ref|XP_003396231.1| PREDICTED: phospholipase DDHD1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|242014961|ref|XP_002428147.1| phospholipase ddhd1, putative [Pediculus humanus corporis] gi|212512690|gb|EEB15409.1| phospholipase ddhd1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345492992|ref|XP_003426970.1| PREDICTED: phospholipase DDHD1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307183315|gb|EFN70184.1| Phospholipase DDHD1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|432938315|ref|XP_004082530.1| PREDICTED: phospholipase DDHD1-like [Oryzias latipes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
MGI|MGI:2150302 547 Ddhd1 "DDHD domain containing 1.0 0.303 0.568 1.1e-48
UNIPROTKB|G3N1K0 835 DDHD1 "Phospholipase DDHD1" [B 1.0 0.198 0.568 1.3e-48
UNIPROTKB|F1N1C0 875 DDHD1 "Phospholipase DDHD1" [B 1.0 0.189 0.568 1.7e-48
UNIPROTKB|O46606 875 DDHD1 "Phospholipase DDHD1" [B 1.0 0.189 0.568 1.7e-48
UNIPROTKB|E1C0T5 807 DDHD1 "Uncharacterized protein 1.0 0.205 0.568 2.3e-48
RGD|1308576 855 Ddhd1 "DDHD domain containing 1.0 0.194 0.573 2.5e-48
UNIPROTKB|I3LK98 875 DDHD1 "Uncharacterized protein 1.0 0.189 0.562 6.1e-48
UNIPROTKB|E2RE74 884 DDHD1 "Uncharacterized protein 1.0 0.187 0.562 6.4e-48
UNIPROTKB|Q8NEL9 900 DDHD1 "Phospholipase DDHD1" [H 1.0 0.184 0.562 6.9e-48
UNIPROTKB|F1SFE1 903 DDHD1 "Uncharacterized protein 1.0 0.183 0.562 7e-48
MGI|MGI:2150302 Ddhd1 "DDHD domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 508 (183.9 bits), Expect = 1.1e-48, P = 1.1e-48
 Identities = 96/169 (56%), Positives = 122/169 (72%)

Query:     1 TGYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYF 60
             +G RL RGY ++A   D+P   SH+VFVVHG+GQKMD GRIIKN    RE+   +++K+F
Sbjct:    31 SGTRLHRGYVEEATLEDKPSQTSHIVFVVHGIGQKMDQGRIIKNTAMMREAARKMEEKHF 90

Query:    61 ASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQ 120
             ++     EF PVEWRS L LDGD V+SIT   V  LR MLN+SAMDIMYYTSP+Y  E+ 
Sbjct:    91 SNHATHVEFLPVEWRSKLTLDGDTVDSITPDKVRGLRDMLNSSAMDIMYYTSPLYRDELV 150

Query:   121 QGLTDELNRLYSMFVARNPNHN---AKISIIAHSLGCVIVYDVITGWIP 166
             +GL  ELNRLYS+F +RNP+      K+SI++HSLGCVI YD++ GW P
Sbjct:   151 KGLQQELNRLYSLFCSRNPDFEEKGGKVSIVSHSLGCVITYDIMMGWNP 199




GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0005737 "cytoplasm" evidence=IEA
GO:0006629 "lipid metabolic process" evidence=IEA
GO:0008150 "biological_process" evidence=ND
GO:0016042 "lipid catabolic process" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
UNIPROTKB|G3N1K0 DDHD1 "Phospholipase DDHD1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1N1C0 DDHD1 "Phospholipase DDHD1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O46606 DDHD1 "Phospholipase DDHD1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0T5 DDHD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1308576 Ddhd1 "DDHD domain containing 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LK98 DDHD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RE74 DDHD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NEL9 DDHD1 "Phospholipase DDHD1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SFE1 DDHD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8NEL9DDHD1_HUMAN3, ., 1, ., 1, ., -0.56211.00.1844yesN/A
Q80YA3DDHD1_MOUSE3, ., 1, ., 1, ., -0.56801.00.3034yesN/A
O46606DDHD1_BOVIN3, ., 1, ., 1, ., -0.56801.00.1897yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 166
KOG2308|consensus 741 100.0
KOG2308|consensus 741 98.03
PF05057 217 DUF676: Putative serine esterase (DUF676); InterPr 97.6
cd00741 153 Lipase Lipase. Lipases are esterases that can hydr 96.57
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 96.42
PF00975 229 Thioesterase: Thioesterase domain; InterPro: IPR00 96.16
PF07819 225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 96.14
PF00151 331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 96.14
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 95.65
PLN02454 414 triacylglycerol lipase 95.51
COG3208 244 GrsT Predicted thioesterase involved in non-riboso 95.38
KOG1455|consensus 313 95.23
PF05990 233 DUF900: Alpha/beta hydrolase of unknown function ( 95.22
PLN02761 527 lipase class 3 family protein 95.0
TIGR02427 251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 94.98
PLN02733 440 phosphatidylcholine-sterol O-acyltransferase 94.95
PRK10749 330 lysophospholipase L2; Provisional 94.94
PRK10673 255 acyl-CoA esterase; Provisional 94.88
PRK11126 242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 94.82
PLN02310 405 triacylglycerol lipase 94.81
PLN02324 415 triacylglycerol lipase 94.77
PHA02857 276 monoglyceride lipase; Provisional 94.72
PLN02211 273 methyl indole-3-acetate methyltransferase 94.61
KOG2564|consensus 343 94.52
PLN02408 365 phospholipase A1 94.34
COG2267 298 PldB Lysophospholipase [Lipid metabolism] 94.25
PRK10566 249 esterase; Provisional 94.19
PF12697 228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 94.11
PLN02571 413 triacylglycerol lipase 94.08
COG2819 264 Predicted hydrolase of the alpha/beta superfamily 93.99
PF02450 389 LCAT: Lecithin:cholesterol acyltransferase; InterP 93.89
PRK00870 302 haloalkane dehalogenase; Provisional 93.85
PF10230 266 DUF2305: Uncharacterised conserved protein (DUF230 93.84
PLN02965 255 Probable pheophorbidase 93.84
PF00561 230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 93.81
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 93.73
PLN02385 349 hydrolase; alpha/beta fold family protein 93.61
PLN02824 294 hydrolase, alpha/beta fold family protein 93.55
PLN02298 330 hydrolase, alpha/beta fold family protein 93.52
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 93.52
TIGR01607 332 PST-A Plasmodium subtelomeric family (PST-A). Thes 93.44
KOG2369|consensus 473 93.4
PLN03037 525 lipase class 3 family protein; Provisional 93.33
TIGR03611 257 RutD pyrimidine utilization protein D. This protei 93.3
cd00707 275 Pancreat_lipase_like Pancreatic lipase-like enzyme 93.22
TIGR02240 276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 93.11
PLN02802 509 triacylglycerol lipase 93.1
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 93.0
KOG1454|consensus 326 92.91
TIGR03502 792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 92.78
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 92.59
PLN02162 475 triacylglycerol lipase 92.52
PRK10349 256 carboxylesterase BioH; Provisional 92.39
PRK11460 232 putative hydrolase; Provisional 92.3
PLN00413 479 triacylglycerol lipase 92.04
PRK03592 295 haloalkane dehalogenase; Provisional 91.93
PLN02753 531 triacylglycerol lipase 91.91
PLN02934 515 triacylglycerol lipase 91.85
PRK11071 190 esterase YqiA; Provisional 91.82
TIGR01738 245 bioH putative pimeloyl-BioC--CoA transferase BioH. 91.79
PLN02679 360 hydrolase, alpha/beta fold family protein 91.74
PLN02719 518 triacylglycerol lipase 91.74
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 91.74
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 91.66
TIGR03100 274 hydr1_PEP hydrolase, ortholog 1, exosortase system 91.54
TIGR01392 351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 91.4
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 91.15
TIGR03343 282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 91.09
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 91.08
PRK03204 286 haloalkane dehalogenase; Provisional 90.91
COG3319 257 Thioesterase domains of type I polyketide synthase 90.79
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 90.51
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 90.49
PLN02652 395 hydrolase; alpha/beta fold family protein 90.28
PLN02442 283 S-formylglutathione hydrolase 89.99
PRK05855 582 short chain dehydrogenase; Validated 89.85
PRK06489 360 hypothetical protein; Provisional 89.8
COG3545181 Predicted esterase of the alpha/beta hydrolase fol 89.7
TIGR01836 350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 89.6
PRK08775 343 homoserine O-acetyltransferase; Provisional 89.58
PRK14875 371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 89.44
COG0412 236 Dienelactone hydrolase and related enzymes [Second 89.27
TIGR01249 306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 89.22
PRK10985 324 putative hydrolase; Provisional 89.17
PLN02511 388 hydrolase 88.99
PLN03087 481 BODYGUARD 1 domain containing hydrolase; Provision 88.82
PLN00021 313 chlorophyllase 88.74
PF01674 219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 88.72
TIGR02821 275 fghA_ester_D S-formylglutathione hydrolase. This m 88.64
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 88.58
PLN02847 633 triacylglycerol lipase 87.98
PF05277 345 DUF726: Protein of unknown function (DUF726); Inte 87.87
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 87.58
PF11187 224 DUF2974: Protein of unknown function (DUF2974); In 87.57
COG4782 377 Uncharacterized protein conserved in bacteria [Fun 87.43
PLN02894 402 hydrolase, alpha/beta fold family protein 87.01
PRK07581 339 hypothetical protein; Validated 86.74
PLN02578 354 hydrolase 86.53
smart00824 212 PKS_TE Thioesterase. Peptide synthetases are invol 85.59
KOG4569|consensus 336 85.52
KOG3724|consensus 973 85.24
KOG3101|consensus 283 85.22
PTZ00472 462 serine carboxypeptidase (CBP1); Provisional 84.74
PRK00175 379 metX homoserine O-acetyltransferase; Provisional 84.56
PLN02980 1655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 84.05
COG0596 282 MhpC Predicted hydrolases or acyltransferases (alp 84.02
PF11144 403 DUF2920: Protein of unknown function (DUF2920); In 83.51
PRK13604 307 luxD acyl transferase; Provisional 83.49
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 83.39
PF02089 279 Palm_thioest: Palmitoyl protein thioesterase; Inte 83.39
PRK06765 389 homoserine O-acetyltransferase; Provisional 82.37
PF06028 255 DUF915: Alpha/beta hydrolase of unknown function ( 82.01
PF05728 187 UPF0227: Uncharacterised protein family (UPF0227); 81.66
PLN02872 395 triacylglycerol lipase 81.35
PF07082 250 DUF1350: Protein of unknown function (DUF1350); In 80.26
>KOG2308|consensus Back     alignment and domain information
Probab=100.00  E-value=6.8e-42  Score=310.13  Aligned_cols=166  Identities=43%  Similarity=0.718  Sum_probs=154.9

Q ss_pred             CCceecccCCcccccCCCCCCCCeEEEEEeCCCCCCCchhHHhhhHHHHHHHHHHHHhcccCCC---CCeEEEeeecc--
Q psy18225          1 TGYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSK---LRAEFFPVEWR--   75 (166)
Q Consensus         1 ~~~~l~rg~~~~~~~~~~~~~i~hLvlVVHGIG~~~~~~~~~~~~~~fr~~~~~l~~~~~~~~~---~~v~~~pI~W~--   75 (166)
                      .|+.|+|+|.+++.+.+++++|+||||+||||||.++.+.+.+|+..||....++.++|+.+..   .|++|+||+|+  
T Consensus       270 ~~~~l~~~~~ee~~~~~k~~~v~hllf~vhgig~~~~~~~i~~n~~~~r~~~~~~~~sh~~~~~~r~v~v~fLpv~w~~~  349 (741)
T KOG2308|consen  270 VGRGLRRFLEEENDLASKPVPVDHLLFVVHGIGQKMKDNSIIENVDSFRELPKALGESHLKNSSDRPVRVLFLPVEWRKG  349 (741)
T ss_pred             cccccchhhhhhccccCCCccchheeeeeeccccCccccchhhcchhHHHHHHHHHHhhhccccCCccceeEEEeeeeEc
Confidence            4788999999999999999999999999999999998888999999999999999999998754   45799999999  


Q ss_pred             CCccccCCccccccchhhhhhHHHhhhhhhhhhcccCchhhHHHHHHHHHHHHHHHHHHHhcCCCCCccEEEEecChhhH
Q psy18225         76 SSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQQGLTDELNRLYSMFVARNPNHNAKISIIAHSLGCV  155 (166)
Q Consensus        76 ~~l~~d~~~~~~it~~~i~~lR~~~~~~~~Dvl~y~sp~y~~~I~~~v~~~lN~~y~~f~~~~p~F~G~VsiigHSLGsv  155 (166)
                      +....+...+++||+++++.+|.|+|++++|||+|+||.|+++|+..|+.++|++|.+|+.+||.|+|+|+|.||||||+
T Consensus       350 ~~~~~~~~~v~~Itl~~i~~~R~~lnst~lDilyY~Splyrq~Iv~~V~~elNr~y~lf~~rnPef~G~Vsi~gHSLGSv  429 (741)
T KOG2308|consen  350 GEKTEDVNFVDDITLDSIPRKRIFLNSTALDILYYMSPLYRQEIVKGVARELNRLYALFKDRNPEFNGKVSIAGHSLGSV  429 (741)
T ss_pred             cchhccccchhhcccccchhHHhhccchhhhhcccCChHHHHHHHHHHHHHHHHHHHHHHhcChhhcCceeeccCCCCce
Confidence            44455667889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhcCC-CC
Q psy18225        156 IVYDVITGW-IP  166 (166)
Q Consensus       156 I~~DiL~~~-~~  166 (166)
                      |+|||||.+ +|
T Consensus       430 it~Dil~~q~~P  441 (741)
T KOG2308|consen  430 ITYDILSHQRSP  441 (741)
T ss_pred             EEEeecccccCc
Confidence            999999999 46



>KOG2308|consensus Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>KOG2564|consensus Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>KOG2369|consensus Back     alignment and domain information
>PLN03037 lipase class 3 family protein; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>KOG1454|consensus Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>PLN02162 triacylglycerol lipase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>PLN02934 triacylglycerol lipase Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>KOG4569|consensus Back     alignment and domain information
>KOG3724|consensus Back     alignment and domain information
>KOG3101|consensus Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 47.9 bits (113), Expect = 4e-07
 Identities = 33/155 (21%), Positives = 53/155 (34%), Gaps = 28/155 (18%)

Query: 12  QALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEF-F 70
           QAL   RP        ++ G+     SG   K          W+      S K++ +  F
Sbjct: 142 QALLELRPAKN----VLIDGVL---GSG---KT---------WVALDVCLSYKVQCKMDF 182

Query: 71  PVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTSPIYGSEIQQGLTDEL-NR 129
            + W  +L         +  L  L  +   N ++         +    IQ  L   L ++
Sbjct: 183 KIFW-LNLKNCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSK 241

Query: 130 LY--SMFVARNPNHNAKISIIAHSLGCVIVYDVIT 162
            Y   + V  N   NAK    A +L C I+  + T
Sbjct: 242 PYENCLLVLLNVQ-NAKA-WNAFNLSCKIL--LTT 272


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
3ds8_A 254 LIN2722 protein; unkonwn function, structural geno 97.37
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 96.84
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 96.5
1tgl_A 269 Triacyl-glycerol acylhydrolase; carboxylic esteras 96.22
1tib_A 269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 95.91
1lgy_A 269 Lipase, triacylglycerol lipase; hydrolase (carboxy 95.78
1tia_A 279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 95.78
1uwc_A 261 Feruloyl esterase A; hydrolase, serine esterase, x 95.75
3h04_A 275 Uncharacterized protein; protein with unknown func 95.75
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 95.56
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 95.46
1ufo_A 238 Hypothetical protein TT1662; alpha-beta fold, hydr 95.41
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 95.32
3ils_A 265 PKS, aflatoxin biosynthesis polyketide synthase; A 95.24
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 95.17
3g7n_A 258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 95.15
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 95.15
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 95.1
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 95.07
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 95.06
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 95.03
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 95.01
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 95.0
3o0d_A 301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 94.99
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 94.95
3ngm_A 319 Extracellular lipase; secret lipase, hydrolase; 2. 94.92
2pbl_A 262 Putative esterase/lipase/thioesterase; alpha/beta- 94.91
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 94.89
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 94.85
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 94.82
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 94.82
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 94.8
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 94.77
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 94.76
3tjm_A 283 Fatty acid synthase; thioesterase domain, fatty ac 94.76
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 94.75
1tqh_A 247 Carboxylesterase precursor; tetrahedral intermedia 94.72
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 94.71
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 94.71
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 94.69
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 94.67
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 94.65
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 94.64
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 94.63
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 94.61
3qyj_A 291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 94.57
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 94.55
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 94.54
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 94.53
3lp5_A 250 Putative cell surface hydrolase; structural genom 94.52
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 94.51
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 94.5
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 94.49
3qmv_A 280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 94.47
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 94.45
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 94.42
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 94.41
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 94.41
3uue_A 279 LIP1, secretory lipase (family 3); LID-domain, hyd 94.4
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 94.38
2k2q_B 242 Surfactin synthetase thioesterase subunit; A/B-hyd 94.38
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 94.35
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 94.34
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 94.34
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 94.33
4fle_A 202 Esterase; structural genomics, PSI-biology, northe 94.33
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 94.33
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 94.31
1iup_A 282 META-cleavage product hydrolase; aromatic compound 94.29
1ehy_A 294 Protein (soluble epoxide hydrolase); alpha/beta hy 94.29
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 94.25
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 94.22
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 94.19
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 94.19
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 94.17
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 94.17
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 94.17
3llc_A 270 Putative hydrolase; structural genomics, joint cen 94.14
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 94.13
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 94.11
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 94.05
1uxo_A 192 YDEN protein; hydrolase, A/B hydrolase, esterase, 94.02
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 94.02
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 94.0
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 93.95
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 93.95
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 93.95
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 93.92
2qmq_A 286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 93.88
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 93.79
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 93.77
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 93.73
2qs9_A 194 Retinoblastoma-binding protein 9; B5T overexpresse 93.73
1r3d_A 264 Conserved hypothetical protein VC1974; structural 93.71
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 93.71
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 93.69
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 93.69
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 93.66
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 93.65
3tej_A 329 Enterobactin synthase component F; nonribosomal pe 93.65
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 93.61
3f67_A 241 Putative dienelactone hydrolase; alpha-beta-alpha 93.6
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 93.59
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 93.54
3icv_A 316 Lipase B, CALB; circular permutation, cleavage on 93.53
2x5x_A 342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 93.51
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 93.47
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 93.44
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 93.43
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 93.42
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 93.41
1jmk_C 230 SRFTE, surfactin synthetase; thioesterase, non-rib 93.4
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 93.4
3lcr_A 319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 93.36
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 93.36
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 93.34
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 93.34
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 93.26
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 93.21
2px6_A 316 Thioesterase domain; thioesaterse domain, orlistat 93.19
1ex9_A 285 Lactonizing lipase; alpha-beta hydrolase fold, pho 93.17
2i3d_A 249 AGR_C_3351P, hypothetical protein ATU1826; structu 93.14
1ei9_A 279 Palmitoyl protein thioesterase 1; alpha/beta hydro 93.11
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 93.11
2hfk_A 319 Pikromycin, type I polyketide synthase pikaiv; alp 93.05
1kez_A 300 Erythronolide synthase; polyketide synthase, modul 93.0
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 92.94
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 92.9
2vat_A 444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 92.87
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 92.82
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 92.79
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 92.77
3fle_A 249 SE_1780 protein; structural genomics, APC61035.1, 92.76
2cb9_A 244 Fengycin synthetase; thioesterase, non-ribosomal p 92.72
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 92.71
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 92.62
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 92.59
4fbl_A 281 LIPS lipolytic enzyme; thermostable, structural ge 92.57
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 92.39
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 92.15
1ycd_A 243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 92.05
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 92.01
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 91.21
3d0k_A 304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 91.91
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 91.83
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 91.69
3i6y_A 280 Esterase APC40077; lipase, structural genomics, PS 91.65
1ys1_X 320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 91.63
2q0x_A 335 Protein DUF1749, uncharacterized protein; alpha/be 91.47
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 91.31
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 90.99
2uz0_A 263 Esterase, tributyrin esterase; alpha/beta hydrolas 90.95
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 90.83
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 90.76
2ory_A 346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 90.72
1dqz_A 280 85C, protein (antigen 85-C); fibronectin, structur 90.63
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 90.59
3ls2_A 280 S-formylglutathione hydrolase; psychrophilic organ 90.58
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 90.41
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 90.09
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 90.06
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 90.03
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 90.03
3e4d_A 278 Esterase D; S-formylglutathione hydrolase, hydrola 89.78
1sfr_A 304 Antigen 85-A; alpha/beta hydrolase, structural gen 89.74
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 89.74
1jfr_A 262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 89.65
1gkl_A 297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 89.41
2fx5_A 258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 89.33
1qoz_A 207 AXE, acetyl xylan esterase; hydrolase, xylan degra 89.32
2yij_A 419 Phospholipase A1-iigamma; hydrolase; 2.00A {Arabid 88.67
2dsn_A 387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 88.91
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 88.77
3g02_A 408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 88.64
4i19_A 388 Epoxide hydrolase; structural genomics, PSI-biolog 88.54
1g66_A 207 Acetyl xylan esterase II; serine hydrolase, acetyl 88.51
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 88.4
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 87.95
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 87.93
3n2z_B 446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 87.82
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 87.75
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 87.56
3fcx_A 282 FGH, esterase D, S-formylglutathione hydrolase; re 87.55
2hih_A 431 Lipase 46 kDa form; A1 phospholipase, phospholipid 87.38
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 87.17
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 87.15
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 86.8
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 86.78
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 86.77
1qlw_A 328 Esterase; anisotropic refinement, atomic resolutio 86.76
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 86.5
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 86.46
4b6g_A 283 Putative esterase; hydrolase, formaldehyde detoxif 86.06
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 85.87
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 85.78
4fhz_A 285 Phospholipase/carboxylesterase; alpha/beta hydrola 85.66
1r88_A 280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 85.57
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 85.53
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 85.27
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 84.49
3vis_A 306 Esterase; alpha/beta-hydrolase fold, polyethylene 84.35
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 84.06
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 83.86
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 83.51
3mve_A 415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 83.3
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 83.15
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 83.13
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 82.84
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 82.63
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 82.46
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 82.34
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 81.95
3hc7_A 254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 81.9
3c8d_A 403 Enterochelin esterase; alpha-beta-alpha sandwich, 81.78
3gff_A 331 IROE-like serine hydrolase; NP_718593.1, structura 81.67
3d59_A 383 Platelet-activating factor acetylhydrolase; secret 81.57
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 81.41
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 81.01
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 80.86
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 80.67
4f21_A246 Carboxylesterase/phospholipase family protein; str 80.36
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 80.33
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 80.22
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 80.16
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
Probab=97.37  E-value=0.0011  Score=52.14  Aligned_cols=22  Identities=14%  Similarity=0.218  Sum_probs=19.0

Q ss_pred             ccEEEEecChhhHHHHHhhcCC
Q psy18225        143 AKISIIAHSLGCVIVYDVITGW  164 (166)
Q Consensus       143 G~VsiigHSLGsvI~~DiL~~~  164 (166)
                      .++.++||||||.++...+..+
T Consensus        94 ~~~~lvGHS~Gg~ia~~~~~~~  115 (254)
T 3ds8_A           94 TQMDGVGHSNGGLALTYYAEDY  115 (254)
T ss_dssp             SEEEEEEETHHHHHHHHHHHHS
T ss_pred             CceEEEEECccHHHHHHHHHHc
Confidence            6899999999999998877643



>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>2yij_A Phospholipase A1-iigamma; hydrolase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 97.08
d1pjaa_ 268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 96.52
d1rp1a2 337 Pancreatic lipase, N-terminal domain {Dog (Canis f 96.27
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 96.07
d1lgya_ 265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 95.92
d1tiba_ 269 Triacylglycerol lipase {Thermomyces lanuginosus, f 95.86
d1uwca_ 261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 95.84
d1jmkc_ 230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 95.67
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 95.58
d1bu8a2 338 Pancreatic lipase, N-terminal domain {Rat (Rattus 95.56
d3tgla_ 265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 95.54
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 95.34
d1tiaa_ 271 Triacylglycerol lipase {Penicillium camembertii [T 95.2
d1uxoa_ 186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 95.16
d2h7xa1 283 Picromycin polyketide synthase {Streptomyces venez 95.14
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 95.13
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 95.12
d1ei9a_ 279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 95.09
d1mo2a_ 255 Erythromycin polyketide synthase {Saccharopolyspor 95.0
d1ex9a_ 285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 94.87
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 94.65
d1cvla_ 319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 94.29
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 93.99
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 93.97
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 93.83
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 93.65
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 93.41
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 93.31
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 93.31
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 93.23
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 93.16
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 93.0
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 92.93
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 92.7
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 92.7
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 92.32
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 92.26
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 92.02
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 91.28
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 90.81
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 90.45
d1m33a_ 256 Biotin biosynthesis protein BioH {Escherichia coli 89.81
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 89.55
d1vkha_ 263 Putative serine hydrolase Ydr428c {Baker's yeast ( 88.86
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 88.59
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 88.37
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 87.7
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 87.33
d1ku0a_ 388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 86.73
d1sfra_ 288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 86.53
d1dqza_ 280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 86.44
d1pv1a_ 299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 85.3
d1r88a_ 267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 83.95
d2pbla1 261 Uncharacterized protein TM1040_2492 {Silicibacter 83.85
d1ufoa_ 238 Hypothetical protein TT1662 {Thermus thermophilus 82.77
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 82.75
d1g66a_ 207 Acetylxylan esterase {Penicillium purpurogenum [Ta 82.21
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 81.37
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 81.14
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 81.03
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 80.25
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 80.08
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Thioesterases
domain: Myristoyl-ACP-specific thioesterase
species: Vibrio harveyi [TaxId: 669]
Probab=97.08  E-value=0.0023  Score=49.79  Aligned_cols=20  Identities=40%  Similarity=0.685  Sum_probs=17.0

Q ss_pred             ccEEEEecChhhHHHHHhhc
Q psy18225        143 AKISIIAHSLGCVIVYDVIT  162 (166)
Q Consensus       143 G~VsiigHSLGsvI~~DiL~  162 (166)
                      .+|.|+||||||.|++-+-.
T Consensus       103 ~~i~lvG~SmGG~ial~~A~  122 (302)
T d1thta_         103 QNIGLIAASLSARVAYEVIS  122 (302)
T ss_dssp             CCEEEEEETHHHHHHHHHTT
T ss_pred             ceeEEEEEchHHHHHHHHhc
Confidence            48999999999999986543



>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure