Diaphorina citri psyllid: psy18229

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MFMVASSVVLTVVVLNYHHRTADSHEMPDWIRFLFLQWIPWILCMQRPHKKITRKTIAMSNKMRELELKERTSKSLMANVLNIDDDFRHVTASSMSNSSNFIRSEVLLSQQ
cEEEEEEEEEEEEEEEECccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHcccHHHHHHHHccccccccccccccccccccccccccccccccccccHHccc
MFMVASSVVLTVVVLNYHHRTADSHEMPDWIRFLFLQWIPWILCMQRP*******************************VLNI****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFMVASSVVLTVVVLNYHHRTADSHEMPDWIRFLFLQWIPWILCMQRPHKKITRKTIAMSNKMRELELKERTSKSLMANVLNIDDDFRHVTASSMSNSSNFIRSEVLLSQQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0009897 [CC]external side of plasma membraneprobableGO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0035094 [BP]response to nicotineprobableGO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:0043279, GO:1901698, GO:0014070
GO:0008144 [MF]drug bindingprobableGO:0003674, GO:0005488
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0042166 [MF]acetylcholine bindingprobableGO:0043169, GO:0042165, GO:0043167, GO:0003674, GO:0050997, GO:0005488
GO:0005892 [CC]acetylcholine-gated channel complexprobableGO:0043234, GO:0043235, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0034702, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0015464 [MF]acetylcholine receptor activityprobableGO:0030594, GO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AQ5, chain B
Confidence level:very confident
Coverage over the Query: 1-34
View the alignment between query and template
View the model in PyMOL