Diaphorina citri psyllid: psy18230

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
TGYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTD
cccccccccccccccccccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEECccccccccccccccccccHHHHHHHHHHHHHHHccccc
*GYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TGYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phospholipase DDHD1 Probable phospholipase that hydrolyzes phosphatidic acid. The different isoforms may change the substrate specificity.confidentQ80YA3
Phospholipase DDHD1 Phospholipase that hydrolyzes phosphatidic acid.confidentO46606
Phospholipase DDHD1 Probable phospholipase that hydrolyzes phosphatidic acid. The different isoforms may change the substrate specificity.confidentQ8NEL9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!