Diaphorina citri psyllid: psy18232


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480------
MKKKTTFCVYLEVQSIILCPFIFQGLSLGHLAKTFHHSATLSRPLVPIVIEQTGRGERAYDIYSRLLRERIICVMGPIDDSLSSVVVAQLLFLQSESSKKPIHMYINSPGGSVTSGLGIYDTMQYVLPPIATWCVGQACSMASLLLAAGEKGMRHSLPNSRIMIHQPSGGVQVGLGIYDTMQYVLPPIATWCVGQACSMASLLLAAGEKGMRHSLPNSRIMIHQPSGGVQGQATDIQIQAEEIINLKKQINGLYVKHTGLSIEKIGKSTVCFYVLHDPYICFWINGLYVKHTGLSIEKIGKSTNLTEELSSVVKVTYITNFHKIGAWFVNYSEATTMKKKTTFCVYLEVQSIILCPFIFQGLSLGHLAKTFHHSATLSRPLVPIVIEQTGRGERAYDIYSRLLRERIICVMGPVSLYPITHSFANDSICKCCHGRRIIRIDGSNDFFLLLCEQLSLDDISCEERSITLLALILALYPYGYIQIATL
cccccccHHHHHHHHHHHccccccccccccccccccccccccccccCEEEEEcccccccHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHccccccccEEEEEcccccCEEccccHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccccEEECccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccccccccccccHHHHHHccccEEEEcccccccccccccEEEEEEEccEEEEEEEEEcccccccccccHHHHHHHHHHHHcccHHHccccccccccccccccccccccCEEEEEEcccccccHHHHHHHHcccEEEEccccccccccccHHHHHHHHcccccccccccccccEEEEEEcccccccccccccHHHHHHHHHHHccccEEEEEcc
*****TFCVYLEVQSIILCPFIFQGLSLGHLAKTFHHSATLSRPLVPIVIEQTGRGERAYDIYSRLLRERIICVMGPIDDSLSSVVVAQLLFLQSESSKKPIHMYINSPGGSVTSGLGIYDTMQYVLPPIATWCVGQACSMASLLLAAGEKGMRHSLPNSRIMIHQPSGGVQVGLGIYDTMQYVLPPIATWCVGQACSMASLLLAAGEKGMRHSLPNSRIMIHQPSGGVQGQATDIQIQAEEIINLKKQINGLYVKHTGLSIEKIGKSTVCFYVLHDPYICFWINGLYVKHTGLSIEKIGKSTNLTEELSSVVKVTYITNFHKIGAWFVNYSEATTMKKKTTFCVYLEVQSIILCPFIFQGLSLGHLAKTFHHS*TLSRPLVPIVIEQTGRGERAYDIYSRLLRERIICVMGPVSLYPITHSFANDSICKCCHGRRIIRIDGSNDFFLLLCEQLSLDDISCEERSITLLALILALYPYGYIQIATL
xxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKKTTFCVYLEVQSIILCPFIFQGLSLGHLAKTFHHSATLSRPLVPIVIEQTGRGERAYDIYSRLLRERIICVMGPIDDSLSSVVVAQLLFLQSESSKKPIHMYINSPGGSVTSGLGIYDTMQYVLPPIATWCVGQACSMASLLLAAGEKGMRHSLPNSRIMIHQPSGGVQVGLGIYDTMQYVLPPIATWCVGQACSMASLLLAAGEKGMRHSLPNSRIMIHQPSGGVQGQATDIQIQAEEIINLKKQINGLYVKHTGLSIEKIGKSTVCFYVLHDPYICFWINGLYVKHTGLSIEKIGKSTNLTEELSSVVKVTYITNFHKIGAWFVNYSEATTMKKKTTFCVYLEVQSIILCPFIFQGLSLGHLAKTFHHSATLSRPLVPIVIEQTGRGERAYDIYSRLLRERIICVMGPVSLYPITHSFANDSICKCCHGRRIIRIDGSNDFFLLLCEQLSLDDISCEERSITLLALILALYPYGYIQIATL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent Clp protease proteolytic subunit 1, mitochondrial Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. Clp may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates.confidentQ27539
Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial Clp cleaves peptides in various proteins in a process that requires ATP hydrolysis. Clp may be responsible for a fairly general and central housekeeping function rather than for the degradation of specific substrates.confidentO88696
ATP-dependent Clp protease proteolytic subunit Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins.confidentQ5GS83

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0009840 [CC]chloroplastic endopeptidase Clp complexprobableGO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0009536, GO:0009532, GO:0009570, GO:0044435, GO:0044434, GO:0009368, GO:0009507, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0009535 [CC]chloroplast thylakoid membraneprobableGO:0055035, GO:0034357, GO:0031976, GO:0043229, GO:0043227, GO:0043226, GO:0009579, GO:0009534, GO:0009536, GO:0016020, GO:0044436, GO:0044435, GO:0044434, GO:0005737, GO:0044446, GO:0031984, GO:0042651, GO:0009507, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044422
GO:0051260 [BP]protein homooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0050897 [MF]cobalt ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0004252 [MF]serine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0009266 [BP]response to temperature stimulusprobableGO:0009628, GO:0050896, GO:0008150
GO:0006515 [BP]misfolded or incompletely synthesized protein catabolic processprobableGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0044238, GO:0009057
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1TG6, chain A
Confidence level:very confident
Coverage over the Query: 44-149,208-303
View the alignment between query and template
View the model in PyMOL
Template: 1Y7O, chain A
Confidence level:very confident
Coverage over the Query: 158-232,246-247,263-267,280-317
View the alignment between query and template
View the model in PyMOL
Template: 3MT6, chain R
Confidence level:probable
Coverage over the Query: 59-172,194-196,234-269
View the alignment between query and template
View the model in PyMOL