Psyllid ID: psy18232
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 486 | ||||||
| 242015536 | 252 | ATP-dependent Clp protease proteolytic s | 0.393 | 0.757 | 0.608 | 9e-74 | |
| 321468091 | 235 | hypothetical protein DAPPUDRAFT_231060 [ | 0.360 | 0.744 | 0.643 | 1e-72 | |
| 115634688 | 239 | PREDICTED: putative ATP-dependent Clp pr | 0.366 | 0.744 | 0.605 | 5e-71 | |
| 156541196 | 234 | PREDICTED: putative ATP-dependent Clp pr | 0.372 | 0.773 | 0.602 | 7e-70 | |
| 307204646 | 237 | Putative ATP-dependent Clp protease prot | 0.374 | 0.767 | 0.604 | 1e-69 | |
| 357629245 | 211 | hypothetical protein KGM_01435 [Danaus p | 0.341 | 0.786 | 0.616 | 5e-69 | |
| 91076194 | 234 | PREDICTED: similar to caseinolytic prote | 0.341 | 0.709 | 0.620 | 5e-69 | |
| 307177704 | 234 | Putative ATP-dependent Clp protease prot | 0.339 | 0.705 | 0.632 | 5e-69 | |
| 380012458 | 236 | PREDICTED: putative ATP-dependent Clp pr | 0.339 | 0.699 | 0.618 | 7e-69 | |
| 66515781 | 237 | PREDICTED: putative ATP-dependent Clp pr | 0.339 | 0.696 | 0.618 | 8e-69 |
| >gi|242015536|ref|XP_002428409.1| ATP-dependent Clp protease proteolytic subunit, putative [Pediculus humanus corporis] gi|212513021|gb|EEB15671.1| ATP-dependent Clp protease proteolytic subunit, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 284 bits (726), Expect = 9e-74, Method: Compositional matrix adjust.
Identities = 152/250 (60%), Positives = 167/250 (66%), Gaps = 59/250 (23%)
Query: 19 CPFIFQGLSLGHLAKTFHHSATLSRPLVPIVIEQTGRGERAYDIYSRLLRERIICVMGPI 78
C +F G + K FH PL+P+VIEQTGRGERAYDIYSRLL+ERIICVMG I
Sbjct: 16 CKTLFSKAHQGFIVK-FHSGVKHGVPLIPVVIEQTGRGERAYDIYSRLLKERIICVMGQI 74
Query: 79 DDSLSSVVVAQLLFLQSESSKKPIHMYINSPGGSVTSGLGIYDTMQYVLPPIATWCVGQA 138
D LSSVV+AQLLFLQSE+SKKP+HMYINSPGGSVT+GLGIYDTMQY+LPP+ATWCVGQA
Sbjct: 75 HDELSSVVIAQLLFLQSENSKKPVHMYINSPGGSVTAGLGIYDTMQYILPPVATWCVGQA 134
Query: 139 CSMASLLLAAGEKGMRHSLPNSRIMIHQPSGGVQVGLGIYDTMQYVLPPIATWCVGQACS 198
CSMASLLLAAG GMRH+LPN+RIMIHQPSGGVQ GQA
Sbjct: 135 CSMASLLLAAGASGMRHALPNARIMIHQPSGGVQ---------------------GQA-- 171
Query: 199 MASLLLAAGEKGMRHSLPNSRIMIHQPSGGVQGQATDIQIQAEEIINLKKQINGLYVKHT 258
TDIQIQAEEI+ LKKQIN LYVKHT
Sbjct: 172 -----------------------------------TDIQIQAEEILKLKKQINHLYVKHT 196
Query: 259 GLSIEKIGKS 268
GLSIEKI +S
Sbjct: 197 GLSIEKIEQS 206
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321468091|gb|EFX79078.1| hypothetical protein DAPPUDRAFT_231060 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|115634688|ref|XP_786892.2| PREDICTED: putative ATP-dependent Clp protease proteolytic subunit, mitochondrial-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|156541196|ref|XP_001599209.1| PREDICTED: putative ATP-dependent Clp protease proteolytic subunit, mitochondrial-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307204646|gb|EFN83268.1| Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|357629245|gb|EHJ78139.1| hypothetical protein KGM_01435 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|91076194|ref|XP_971998.1| PREDICTED: similar to caseinolytic protease, ATP-dependent, proteolytic subunit homolog [Tribolium castaneum] gi|270014730|gb|EFA11178.1| hypothetical protein TcasGA2_TC004785 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|307177704|gb|EFN66732.1| Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|380012458|ref|XP_003690300.1| PREDICTED: putative ATP-dependent Clp protease proteolytic subunit, mitochondrial-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|66515781|ref|XP_392540.2| PREDICTED: putative ATP-dependent Clp protease proteolytic subunit, mitochondrial-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 486 | ||||||
| ZFIN|ZDB-GENE-030131-7860 | 266 | clpp "ClpP caseinolytic peptid | 0.304 | 0.556 | 0.763 | 7.8e-62 | |
| MGI|MGI:1858213 | 272 | Clpp "ClpP caseinolytic peptid | 0.302 | 0.540 | 0.775 | 5.7e-59 | |
| UNIPROTKB|Q16740 | 277 | CLPP "Putative ATP-dependent C | 0.292 | 0.512 | 0.795 | 1.5e-58 | |
| RGD|1588583 | 272 | Clpp "ClpP caseinolytic peptid | 0.292 | 0.522 | 0.795 | 1.9e-58 | |
| UNIPROTKB|Q2KHU4 | 272 | CLPP "Putative ATP-dependent C | 0.288 | 0.514 | 0.8 | 4e-58 | |
| UNIPROTKB|F1SBT2 | 273 | CLPP "ATP-dependent Clp protea | 0.292 | 0.520 | 0.781 | 5.1e-58 | |
| UNIPROTKB|E2QUV8 | 301 | CLPP "ATP-dependent Clp protea | 0.261 | 0.421 | 0.812 | 6.9e-55 | |
| FB|FBgn0032229 | 253 | CG5045 [Drosophila melanogaste | 0.263 | 0.505 | 0.804 | 8e-53 | |
| WB|WBGene00014172 | 221 | clpp-1 [Caenorhabditis elegans | 0.277 | 0.610 | 0.691 | 3.7e-52 | |
| TIGR_CMR|ECH_0901 | 199 | ECH_0901 "ATP-dependent Clp pr | 0.263 | 0.643 | 0.718 | 7.7e-50 |
| ZFIN|ZDB-GENE-030131-7860 clpp "ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 603 (217.3 bits), Expect = 7.8e-62, Sum P(2) = 7.8e-62
Identities = 113/148 (76%), Positives = 131/148 (88%)
Query: 25 GLSLGHLAKTFHHSATLSRPLVPIVIEQTGRGERAYDIYSRLLRERIICVMGPIDDSLSS 84
G+S ++++ H S+ S PL+PIV+EQTGRGERAYDIYSRLLRERIICVMGPIDDS++S
Sbjct: 9 GVSTLRVSRSVHQSSPWSSPLIPIVVEQTGRGERAYDIYSRLLRERIICVMGPIDDSVAS 68
Query: 85 VVVAQLLFLQSESSKKPIHMYINSPGGSVTSGLGIYDTMQYVLPPIATWCVGQACSMASL 144
+V+AQLLFLQSES+ KPIHMYINSPGG VTSGL IYDTMQY+L PI+TWCVGQA SM SL
Sbjct: 69 LVIAQLLFLQSESNNKPIHMYINSPGGVVTSGLAIYDTMQYILNPISTWCVGQAASMGSL 128
Query: 145 LLAAGEKGMRHSLPNSRIMIHQPSGGVQ 172
LLAAG GMRHSLPN+RIM+HQPSGG +
Sbjct: 129 LLAAGTAGMRHSLPNARIMVHQPSGGAR 156
|
|
| MGI|MGI:1858213 Clpp "ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q16740 CLPP "Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1588583 Clpp "ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2KHU4 CLPP "Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SBT2 CLPP "ATP-dependent Clp protease proteolytic subunit" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QUV8 CLPP "ATP-dependent Clp protease proteolytic subunit" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032229 CG5045 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00014172 clpp-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|ECH_0901 ECH_0901 "ATP-dependent Clp protease, proteolytic subunit ClpP" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 486 | |||
| PRK00277 | 200 | PRK00277, clpP, ATP-dependent Clp protease proteol | 1e-100 | |
| pfam00574 | 182 | pfam00574, CLP_protease, Clp protease | 4e-80 | |
| cd07017 | 171 | cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) | 1e-78 | |
| COG0740 | 200 | COG0740, ClpP, Protease subunit of ATP-dependent C | 2e-78 | |
| TIGR00493 | 192 | TIGR00493, clpP, ATP-dependent Clp endopeptidase, | 8e-74 | |
| PRK12553 | 207 | PRK12553, PRK12553, ATP-dependent Clp protease pro | 1e-67 | |
| PRK12551 | 196 | PRK12551, PRK12551, ATP-dependent Clp protease pro | 6e-61 | |
| PRK14513 | 201 | PRK14513, PRK14513, ATP-dependent Clp protease pro | 5e-58 | |
| CHL00028 | 200 | CHL00028, clpP, ATP-dependent Clp protease proteol | 7e-51 | |
| PRK14514 | 221 | PRK14514, PRK14514, ATP-dependent Clp protease pro | 2e-43 | |
| PRK12552 | 222 | PRK12552, PRK12552, ATP-dependent Clp protease-lik | 3e-43 | |
| CHL00028 | 200 | CHL00028, clpP, ATP-dependent Clp protease proteol | 3e-38 | |
| cd07013 | 162 | cd07013, S14_ClpP, Caseinolytic protease (ClpP) is | 5e-35 | |
| PRK14512 | 197 | PRK14512, PRK14512, ATP-dependent Clp protease pro | 2e-26 | |
| PRK14512 | 197 | PRK14512, PRK14512, ATP-dependent Clp protease pro | 3e-24 | |
| cd00394 | 161 | cd00394, Clp_protease_like, Caseinolytic protease | 6e-22 | |
| cd07016 | 160 | cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) | 7e-16 | |
| PRK00277 | 200 | PRK00277, clpP, ATP-dependent Clp protease proteol | 8e-16 | |
| cd07016 | 160 | cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) | 1e-14 | |
| cd00394 | 161 | cd00394, Clp_protease_like, Caseinolytic protease | 7e-13 | |
| TIGR00493 | 192 | TIGR00493, clpP, ATP-dependent Clp endopeptidase, | 4e-12 | |
| PRK12551 | 196 | PRK12551, PRK12551, ATP-dependent Clp protease pro | 2e-11 | |
| PRK14513 | 201 | PRK14513, PRK14513, ATP-dependent Clp protease pro | 3e-11 | |
| COG0740 | 200 | COG0740, ClpP, Protease subunit of ATP-dependent C | 1e-10 | |
| pfam00574 | 182 | pfam00574, CLP_protease, Clp protease | 4e-06 | |
| PRK12553 | 207 | PRK12553, PRK12553, ATP-dependent Clp protease pro | 0.002 |
| >gnl|CDD|178955 PRK00277, clpP, ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
Score = 297 bits (763), Expect = e-100
Identities = 106/227 (46%), Positives = 136/227 (59%), Gaps = 58/227 (25%)
Query: 43 RPLVPIVIEQTGRGERAYDIYSRLLRERIICVMGPIDDSLSSVVVAQLLFLQSESSKKPI 102
LVP+VIEQT RGER+YDIYSRLL+ERII + G ++D +++++VAQLLFL++E K I
Sbjct: 5 MNLVPMVIEQTSRGERSYDIYSRLLKERIIFLGGEVEDHMANLIVAQLLFLEAEDPDKDI 64
Query: 103 HMYINSPGGSVTSGLGIYDTMQYVLPPIATWCVGQACSMASLLLAAGEKGMRHSLPNSRI 162
++YINSPGGSVT+GL IYDTMQ++ P ++T C+GQA SM + LLAAG KG R +LPNSRI
Sbjct: 65 YLYINSPGGSVTAGLAIYDTMQFIKPDVSTICIGQAASMGAFLLAAGAKGKRFALPNSRI 124
Query: 163 MIHQPSGGVQVGLGIYDTMQYVLPPIATWCVGQACSMASLLLAAGEKGMRHSLPNSRIMI 222
MIHQP GG Q GQA
Sbjct: 125 MIHQPLGGFQ---------------------GQA-------------------------- 137
Query: 223 HQPSGGVQGQATDIQIQAEEIINLKKQINGLYVKHTGLSIEKIGKST 269
TDI+I A EI+ LKK++N + +HTG +EKI K T
Sbjct: 138 -----------TDIEIHAREILKLKKRLNEILAEHTGQPLEKIEKDT 173
|
Length = 200 |
| >gnl|CDD|201316 pfam00574, CLP_protease, Clp protease | Back alignment and domain information |
|---|
| >gnl|CDD|132928 cd07017, S14_ClpP_2, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >gnl|CDD|223811 COG0740, ClpP, Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|188055 TIGR00493, clpP, ATP-dependent Clp endopeptidase, proteolytic subunit ClpP | Back alignment and domain information |
|---|
| >gnl|CDD|237133 PRK12553, PRK12553, ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|139060 PRK12551, PRK12551, ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237742 PRK14513, PRK14513, ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214340 CHL00028, clpP, ATP-dependent Clp protease proteolytic subunit | Back alignment and domain information |
|---|
| >gnl|CDD|184722 PRK14514, PRK14514, ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183588 PRK12552, PRK12552, ATP-dependent Clp protease-like protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|214340 CHL00028, clpP, ATP-dependent Clp protease proteolytic subunit | Back alignment and domain information |
|---|
| >gnl|CDD|132924 cd07013, S14_ClpP, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >gnl|CDD|237741 PRK14512, PRK14512, ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237741 PRK14512, PRK14512, ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132923 cd00394, Clp_protease_like, Caseinolytic protease (ClpP) is an ATP-dependent protease | Back alignment and domain information |
|---|
| >gnl|CDD|132927 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >gnl|CDD|178955 PRK00277, clpP, ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|132927 cd07016, S14_ClpP_1, Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >gnl|CDD|132923 cd00394, Clp_protease_like, Caseinolytic protease (ClpP) is an ATP-dependent protease | Back alignment and domain information |
|---|
| >gnl|CDD|188055 TIGR00493, clpP, ATP-dependent Clp endopeptidase, proteolytic subunit ClpP | Back alignment and domain information |
|---|
| >gnl|CDD|139060 PRK12551, PRK12551, ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|237742 PRK14513, PRK14513, ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223811 COG0740, ClpP, Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|201316 pfam00574, CLP_protease, Clp protease | Back alignment and domain information |
|---|
| >gnl|CDD|237133 PRK12553, PRK12553, ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 486 | |||
| COG0740 | 200 | ClpP Protease subunit of ATP-dependent Clp proteas | 100.0 | |
| KOG0840|consensus | 275 | 100.0 | ||
| PRK14513 | 201 | ATP-dependent Clp protease proteolytic subunit; Pr | 100.0 | |
| PRK14514 | 221 | ATP-dependent Clp protease proteolytic subunit; Pr | 100.0 | |
| PRK12552 | 222 | ATP-dependent Clp protease-like protein; Reviewed | 100.0 | |
| PRK12551 | 196 | ATP-dependent Clp protease proteolytic subunit; Re | 100.0 | |
| CHL00028 | 200 | clpP ATP-dependent Clp protease proteolytic subuni | 100.0 | |
| TIGR00493 | 191 | clpP ATP-dependent Clp protease, proteolytic subun | 100.0 | |
| PRK00277 | 200 | clpP ATP-dependent Clp protease proteolytic subuni | 100.0 | |
| PRK14512 | 197 | ATP-dependent Clp protease proteolytic subunit; Pr | 100.0 | |
| PRK12553 | 207 | ATP-dependent Clp protease proteolytic subunit; Re | 100.0 | |
| PF00574 | 182 | CLP_protease: Clp protease; InterPro: IPR001907 In | 100.0 | |
| cd07017 | 171 | S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- | 100.0 | |
| cd07013 | 162 | S14_ClpP Caseinolytic protease (ClpP) is an ATP-de | 100.0 | |
| cd07016 | 160 | S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- | 99.94 | |
| cd07015 | 172 | Clp_protease_NfeD Nodulation formation efficiency | 99.92 | |
| cd00394 | 161 | Clp_protease_like Caseinolytic protease (ClpP) is | 99.9 | |
| cd07020 | 187 | Clp_protease_NfeD_1 Nodulation formation efficienc | 99.86 | |
| cd07021 | 178 | Clp_protease_NfeD_like Nodulation formation effici | 99.78 | |
| COG0616 | 317 | SppA Periplasmic serine proteases (ClpP class) [Po | 99.75 | |
| PRK10949 | 618 | protease 4; Provisional | 99.73 | |
| TIGR00705 | 584 | SppA_67K signal peptide peptidase SppA, 67K type. | 99.7 | |
| TIGR00706 | 207 | SppA_dom signal peptide peptidase SppA, 36K type. | 99.62 | |
| cd07023 | 208 | S49_Sppa_N_C Signal peptide peptidase A (SppA), a | 99.6 | |
| cd07022 | 214 | S49_Sppa_36K_type Signal peptide peptidase A (SppA | 99.54 | |
| COG0740 | 200 | ClpP Protease subunit of ATP-dependent Clp proteas | 99.52 | |
| cd07019 | 211 | S49_SppA_1 Signal peptide peptidase A (SppA), a se | 99.49 | |
| cd07014 | 177 | S49_SppA Signal peptide peptidase A. Signal peptid | 99.49 | |
| PRK11778 | 330 | putative inner membrane peptidase; Provisional | 99.43 | |
| PRK14513 | 201 | ATP-dependent Clp protease proteolytic subunit; Pr | 99.39 | |
| cd07018 | 222 | S49_SppA_67K_type Signal peptide peptidase A (SppA | 99.38 | |
| PRK12552 | 222 | ATP-dependent Clp protease-like protein; Reviewed | 99.34 | |
| PRK14514 | 221 | ATP-dependent Clp protease proteolytic subunit; Pr | 99.34 | |
| PRK12551 | 196 | ATP-dependent Clp protease proteolytic subunit; Re | 99.31 | |
| CHL00028 | 200 | clpP ATP-dependent Clp protease proteolytic subuni | 99.29 | |
| KOG0840|consensus | 275 | 99.27 | ||
| PRK14512 | 197 | ATP-dependent Clp protease proteolytic subunit; Pr | 99.16 | |
| cd07016 | 160 | S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- | 99.12 | |
| TIGR00493 | 191 | clpP ATP-dependent Clp protease, proteolytic subun | 99.06 | |
| cd07013 | 162 | S14_ClpP Caseinolytic protease (ClpP) is an ATP-de | 99.05 | |
| PRK00277 | 200 | clpP ATP-dependent Clp protease proteolytic subuni | 99.03 | |
| cd07017 | 171 | S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- | 98.99 | |
| PF01972 | 285 | SDH_sah: Serine dehydrogenase proteinase; InterPro | 98.97 | |
| COG1030 | 436 | NfeD Membrane-bound serine protease (ClpP class) [ | 98.93 | |
| cd07015 | 172 | Clp_protease_NfeD Nodulation formation efficiency | 98.88 | |
| PF00574 | 182 | CLP_protease: Clp protease; InterPro: IPR001907 In | 98.88 | |
| PRK12553 | 207 | ATP-dependent Clp protease proteolytic subunit; Re | 98.86 | |
| TIGR00705 | 584 | SppA_67K signal peptide peptidase SppA, 67K type. | 98.82 | |
| PRK10949 | 618 | protease 4; Provisional | 98.62 | |
| cd07021 | 178 | Clp_protease_NfeD_like Nodulation formation effici | 98.56 | |
| cd00394 | 161 | Clp_protease_like Caseinolytic protease (ClpP) is | 98.49 | |
| PF01343 | 154 | Peptidase_S49: Peptidase family S49 peptidase clas | 98.47 | |
| cd07020 | 187 | Clp_protease_NfeD_1 Nodulation formation efficienc | 98.29 | |
| COG0616 | 317 | SppA Periplasmic serine proteases (ClpP class) [Po | 98.16 | |
| TIGR00706 | 207 | SppA_dom signal peptide peptidase SppA, 36K type. | 97.99 | |
| cd07023 | 208 | S49_Sppa_N_C Signal peptide peptidase A (SppA), a | 97.48 | |
| COG3904 | 245 | Predicted periplasmic protein [Function unknown] | 97.31 | |
| cd07022 | 214 | S49_Sppa_36K_type Signal peptide peptidase A (SppA | 97.29 | |
| cd06558 | 195 | crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy | 96.96 | |
| PRK11778 | 330 | putative inner membrane peptidase; Provisional | 96.91 | |
| PF01972 | 285 | SDH_sah: Serine dehydrogenase proteinase; InterPro | 96.88 | |
| cd07019 | 211 | S49_SppA_1 Signal peptide peptidase A (SppA), a se | 96.61 | |
| cd07018 | 222 | S49_SppA_67K_type Signal peptide peptidase A (SppA | 96.43 | |
| KOG1680|consensus | 290 | 96.35 | ||
| PLN03229 | 762 | acetyl-coenzyme A carboxylase carboxyl transferase | 96.3 | |
| PRK05724 | 319 | acetyl-CoA carboxylase carboxyltransferase subunit | 96.28 | |
| PRK05869 | 222 | enoyl-CoA hydratase; Validated | 96.25 | |
| TIGR00513 | 316 | accA acetyl-CoA carboxylase, carboxyl transferase, | 96.21 | |
| PRK06688 | 259 | enoyl-CoA hydratase; Provisional | 96.11 | |
| PLN03230 | 431 | acetyl-coenzyme A carboxylase carboxyl transferase | 96.09 | |
| cd07014 | 177 | S49_SppA Signal peptide peptidase A. Signal peptid | 95.99 | |
| CHL00198 | 322 | accA acetyl-CoA carboxylase carboxyltransferase al | 95.97 | |
| PRK12319 | 256 | acetyl-CoA carboxylase subunit alpha; Provisional | 95.89 | |
| TIGR03210 | 256 | badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb | 95.83 | |
| PRK06143 | 256 | enoyl-CoA hydratase; Provisional | 95.8 | |
| PRK03580 | 261 | carnitinyl-CoA dehydratase; Provisional | 95.8 | |
| PRK08258 | 277 | enoyl-CoA hydratase; Provisional | 95.71 | |
| PLN02888 | 265 | enoyl-CoA hydratase | 95.7 | |
| PRK07511 | 260 | enoyl-CoA hydratase; Provisional | 95.69 | |
| PRK06190 | 258 | enoyl-CoA hydratase; Provisional | 95.65 | |
| PRK09674 | 255 | enoyl-CoA hydratase-isomerase; Provisional | 95.62 | |
| PRK07854 | 243 | enoyl-CoA hydratase; Provisional | 95.59 | |
| PRK11423 | 261 | methylmalonyl-CoA decarboxylase; Provisional | 95.56 | |
| PRK07509 | 262 | enoyl-CoA hydratase; Provisional | 95.55 | |
| PF00378 | 245 | ECH: Enoyl-CoA hydratase/isomerase family; InterPr | 95.51 | |
| PRK08138 | 261 | enoyl-CoA hydratase; Provisional | 95.49 | |
| PRK07110 | 249 | polyketide biosynthesis enoyl-CoA hydratase; Valid | 95.41 | |
| TIGR01929 | 259 | menB naphthoate synthase (dihydroxynaphthoic acid | 95.37 | |
| PRK05864 | 276 | enoyl-CoA hydratase; Provisional | 95.36 | |
| PRK09076 | 258 | enoyl-CoA hydratase; Provisional | 95.36 | |
| PRK05980 | 260 | enoyl-CoA hydratase; Provisional | 95.32 | |
| PRK07327 | 268 | enoyl-CoA hydratase; Provisional | 95.18 | |
| PRK05809 | 260 | 3-hydroxybutyryl-CoA dehydratase; Validated | 95.15 | |
| PRK05995 | 262 | enoyl-CoA hydratase; Provisional | 95.13 | |
| TIGR02280 | 256 | PaaB1 phenylacetate degradation probable enoyl-CoA | 95.12 | |
| PRK05870 | 249 | enoyl-CoA hydratase; Provisional | 95.12 | |
| PLN02664 | 275 | enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA | 95.05 | |
| PRK08150 | 255 | enoyl-CoA hydratase; Provisional | 95.02 | |
| PLN02600 | 251 | enoyl-CoA hydratase | 94.97 | |
| PRK07658 | 257 | enoyl-CoA hydratase; Provisional | 94.93 | |
| PRK09120 | 275 | p-hydroxycinnamoyl CoA hydratase/lyase; Validated | 94.92 | |
| PRK06495 | 257 | enoyl-CoA hydratase; Provisional | 94.87 | |
| PRK06144 | 262 | enoyl-CoA hydratase; Provisional | 94.8 | |
| PLN02921 | 327 | naphthoate synthase | 94.78 | |
| PRK08140 | 262 | enoyl-CoA hydratase; Provisional | 94.75 | |
| PRK05862 | 257 | enoyl-CoA hydratase; Provisional | 94.61 | |
| PRK09245 | 266 | enoyl-CoA hydratase; Provisional | 94.58 | |
| PRK06072 | 248 | enoyl-CoA hydratase; Provisional | 94.57 | |
| PRK06494 | 259 | enoyl-CoA hydratase; Provisional | 94.54 | |
| PRK06023 | 251 | enoyl-CoA hydratase; Provisional | 94.52 | |
| PRK07468 | 262 | enoyl-CoA hydratase; Provisional | 94.5 | |
| PLN02267 | 239 | enoyl-CoA hydratase/isomerase family protein | 94.5 | |
| PRK07396 | 273 | dihydroxynaphthoic acid synthetase; Validated | 94.42 | |
| PRK05981 | 266 | enoyl-CoA hydratase; Provisional | 94.38 | |
| PRK07260 | 255 | enoyl-CoA hydratase; Provisional | 94.31 | |
| TIGR03189 | 251 | dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy | 94.29 | |
| PRK08321 | 302 | naphthoate synthase; Validated | 94.26 | |
| PRK07827 | 260 | enoyl-CoA hydratase; Provisional | 94.26 | |
| PRK06210 | 272 | enoyl-CoA hydratase; Provisional | 94.21 | |
| PRK08290 | 288 | enoyl-CoA hydratase; Provisional | 94.19 | |
| PRK06213 | 229 | enoyl-CoA hydratase; Provisional | 94.11 | |
| PRK07659 | 260 | enoyl-CoA hydratase; Provisional | 94.01 | |
| PRK06142 | 272 | enoyl-CoA hydratase; Provisional | 93.99 | |
| PRK06127 | 269 | enoyl-CoA hydratase; Provisional | 93.95 | |
| PRK08260 | 296 | enoyl-CoA hydratase; Provisional | 93.89 | |
| PLN03214 | 278 | probable enoyl-CoA hydratase/isomerase; Provisiona | 93.88 | |
| TIGR03134 | 238 | malonate_gamma malonate decarboxylase, gamma subun | 93.78 | |
| PRK08788 | 287 | enoyl-CoA hydratase; Validated | 93.74 | |
| PRK07799 | 263 | enoyl-CoA hydratase; Provisional | 93.72 | |
| PRK06563 | 255 | enoyl-CoA hydratase; Provisional | 93.65 | |
| PRK07657 | 260 | enoyl-CoA hydratase; Provisional | 93.62 | |
| TIGR03200 | 360 | dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy | 93.57 | |
| PRK07938 | 249 | enoyl-CoA hydratase; Provisional | 93.56 | |
| COG3904 | 245 | Predicted periplasmic protein [Function unknown] | 93.53 | |
| PRK08252 | 254 | enoyl-CoA hydratase; Provisional | 93.27 | |
| PRK05674 | 265 | gamma-carboxygeranoyl-CoA hydratase; Validated | 93.09 | |
| PRK08139 | 266 | enoyl-CoA hydratase; Validated | 93.05 | |
| COG1024 | 257 | CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi | 92.8 | |
| PRK12478 | 298 | enoyl-CoA hydratase; Provisional | 92.75 | |
| PLN02157 | 401 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 92.41 | |
| PF01343 | 154 | Peptidase_S49: Peptidase family S49 peptidase clas | 91.97 | |
| PRK08272 | 302 | enoyl-CoA hydratase; Provisional | 91.93 | |
| TIGR02440 | 699 | FadJ fatty oxidation complex, alpha subunit FadJ. | 91.9 | |
| PRK08184 | 550 | benzoyl-CoA-dihydrodiol lyase; Provisional | 91.82 | |
| PRK05617 | 342 | 3-hydroxyisobutyryl-CoA hydrolase; Provisional | 91.75 | |
| PLN02851 | 407 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 90.96 | |
| COG0825 | 317 | AccA Acetyl-CoA carboxylase alpha subunit [Lipid m | 90.87 | |
| PLN02874 | 379 | 3-hydroxyisobutyryl-CoA hydrolase-like protein | 90.69 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 90.62 | |
| PLN02988 | 381 | 3-hydroxyisobutyryl-CoA hydrolase | 90.28 | |
| PRK07112 | 255 | polyketide biosynthesis enoyl-CoA hydratase; Valid | 90.03 | |
| TIGR02437 | 714 | FadB fatty oxidation complex, alpha subunit FadB. | 89.71 | |
| PRK11154 | 708 | fadJ multifunctional fatty acid oxidation complex | 89.45 | |
| PRK08259 | 254 | enoyl-CoA hydratase; Provisional | 89.41 | |
| COG1030 | 436 | NfeD Membrane-bound serine protease (ClpP class) [ | 89.36 | |
| TIGR01117 | 512 | mmdA methylmalonyl-CoA decarboxylase alpha subunit | 88.27 | |
| TIGR03222 | 546 | benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p | 87.41 | |
| TIGR03222 | 546 | benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p | 86.4 | |
| TIGR02441 | 737 | fa_ox_alpha_mit fatty acid oxidation complex, alph | 84.93 | |
| TIGR03133 | 274 | malonate_beta malonate decarboxylase, beta subunit | 84.76 | |
| PRK08184 | 550 | benzoyl-CoA-dihydrodiol lyase; Provisional | 82.48 | |
| PF06833 | 234 | MdcE: Malonate decarboxylase gamma subunit (MdcE); | 82.1 | |
| PF01039 | 493 | Carboxyl_trans: Carboxyl transferase domain; Inter | 80.64 | |
| PLN02820 | 569 | 3-methylcrotonyl-CoA carboxylase, beta chain | 80.44 |
| >COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.9e-53 Score=401.23 Aligned_cols=191 Identities=58% Similarity=0.918 Sum_probs=181.1
Q ss_pred CCcceeecccCCCccccchHhhhccCcEEEEccccCcchHHHHHHHHHhhhhcCCCCCeEEEEeCCCcccchHHHHHHHH
Q psy18232 44 PLVPIVIEQTGRGERAYDIYSRLLRERIICVMGPIDDSLSSVVVAQLLFLQSESSKKPIHMYINSPGGSVTSGLGIYDTM 123 (486)
Q Consensus 44 ~~vP~v~~~~~~~e~~~Di~s~Ll~~RIIfl~G~I~d~~a~~ii~qLl~L~~ed~~k~I~L~INSPGGsv~aglaIyD~I 123 (486)
.++|+++++++++++.+|+|++|+++|+||++|+|++..++.+++||++|+++++.|+|+||||||||+|++|++|||+|
T Consensus 2 ~~~~~~~e~~~~~~~~~di~s~llk~riI~l~g~I~~~~a~~i~aqll~Lea~~~~k~I~lyINSpGG~V~aG~AIydtm 81 (200)
T COG0740 2 ALVPMVIEQTSRGERSYDIYSRLLKERIIFLGGEIEDHMANLIVAQLLFLEAEDPDKDIYLYINSPGGSVTAGLAIYDTM 81 (200)
T ss_pred CCCccccCcccCCCChhhHHHHhhhccEEEEeeeechHHHHHHHHHHHHHHhcCCCCCeEEEEeCCCcccchhHHHHHHH
Confidence 47899999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhcCCCceEEEeccchhHHHHHHHcCCCCcccccCCceeEeecCCCccccchhhhccccccCCCeEEEEecccchhhHHH
Q psy18232 124 QYVLPPIATWCVGQACSMASLLLAAGEKGMRHSLPNSRIMIHQPSGGVQVGLGIYDTMQYVLPPIATWCVGQACSMASLL 203 (486)
Q Consensus 124 ~~ik~~V~tvv~G~AAS~as~Ia~aGd~~~R~a~~ni~I~INSPGG~v~~glAIyD~L~~~~~kItt~vdGlAAS~As~I 203 (486)
+++++||+|+|+| +|||||++|
T Consensus 82 ~~ik~~V~ti~~G----------------------------------------------------------~AaSmgs~l 103 (200)
T COG0740 82 QFIKPPVSTICMG----------------------------------------------------------QAASMGSVL 103 (200)
T ss_pred HhcCCCeEEEEec----------------------------------------------------------HHHhHHHHH
Confidence 9999999999998 555566666
Q ss_pred HhhcccccccccCCceeeecCCCCCccCChHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHHhhhccccccChhhHHHH
Q psy18232 204 LAAGEKGMRHSLPNSRIMIHQPSGGVQGQATDIQIQAEEIINLKKQINGLYVKHTGLSIEKIGKSTVCFYVLHDPYICFW 283 (486)
Q Consensus 204 laAG~~gkR~m~Pna~iMIHqP~gg~~G~a~dI~~~Aeel~~~r~~I~~iYA~~TG~s~E~I~~~m~rd~wmsa~e~~e~ 283 (486)
++||++++|+++|||++|||||+|+..|+++|++++|+|+.+++++++++|+++||+++|+++++++||+||+++
T Consensus 104 ~~aG~~g~r~~lPnsrimIHqP~gg~~G~a~Di~i~A~ei~~~~~~l~~i~a~~TGq~~e~i~~d~drd~~msa~----- 178 (200)
T COG0740 104 LMAGDKGKRFALPNARIMIHQPSGGAQGQASDIEIHAREILKIKERLNRIYAEHTGQTLEKIEKDTDRDTWMSAE----- 178 (200)
T ss_pred HhcCCCCCceeCCCceEEEecCCccCccCHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHhhcccccCCHH-----
Confidence 666667889999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhCCcHHHHhh
Q psy18232 284 INGLYVKHTGLSIEKIGK 301 (486)
Q Consensus 284 L~~~eAk~~GLiDEiI~~ 301 (486)
||+++||+|+++..
T Consensus 179 ----eA~~yGLiD~V~~~ 192 (200)
T COG0740 179 ----EAKEYGLIDKVIES 192 (200)
T ss_pred ----HHHHcCCcceeccc
Confidence 89999999988765
|
|
| >KOG0840|consensus | Back alignment and domain information |
|---|
| >PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12552 ATP-dependent Clp protease-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >CHL00028 clpP ATP-dependent Clp protease proteolytic subunit | Back alignment and domain information |
|---|
| >TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP | Back alignment and domain information |
|---|
| >PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease | Back alignment and domain information |
|---|
| >cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10949 protease 4; Provisional | Back alignment and domain information |
|---|
| >TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type | Back alignment and domain information |
|---|
| >TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type | Back alignment and domain information |
|---|
| >cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07014 S49_SppA Signal peptide peptidase A | Back alignment and domain information |
|---|
| >PRK11778 putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >PRK12552 ATP-dependent Clp protease-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >CHL00028 clpP ATP-dependent Clp protease proteolytic subunit | Back alignment and domain information |
|---|
| >KOG0840|consensus | Back alignment and domain information |
|---|
| >PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP | Back alignment and domain information |
|---|
| >cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease | Back alignment and domain information |
|---|
| >PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily | Back alignment and domain information |
|---|
| >COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed | Back alignment and domain information |
|---|
| >TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type | Back alignment and domain information |
|---|
| >PRK10949 protease 4; Provisional | Back alignment and domain information |
|---|
| >cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease | Back alignment and domain information |
|---|
| >PF01343 Peptidase_S49: Peptidase family S49 peptidase classification | Back alignment and domain information |
|---|
| >cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease | Back alignment and domain information |
|---|
| >COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type | Back alignment and domain information |
|---|
| >cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >COG3904 Predicted periplasmic protein [Function unknown] | Back alignment and domain information |
|---|
| >cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily | Back alignment and domain information |
|---|
| >PRK11778 putative inner membrane peptidase; Provisional | Back alignment and domain information |
|---|
| >PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily | Back alignment and domain information |
|---|
| >cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad | Back alignment and domain information |
|---|
| >KOG1680|consensus | Back alignment and domain information |
|---|
| >PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK05869 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit | Back alignment and domain information |
|---|
| >PRK06688 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional | Back alignment and domain information |
|---|
| >cd07014 S49_SppA Signal peptide peptidase A | Back alignment and domain information |
|---|
| >CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase | Back alignment and domain information |
|---|
| >PRK06143 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK03580 carnitinyl-CoA dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08258 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02888 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK07511 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06190 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09674 enoyl-CoA hydratase-isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK07854 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK11423 methylmalonyl-CoA decarboxylase; Provisional | Back alignment and domain information |
|---|
| >PRK07509 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix | Back alignment and domain information |
|---|
| >PRK08138 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) | Back alignment and domain information |
|---|
| >PRK05864 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09076 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05980 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07327 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated | Back alignment and domain information |
|---|
| >PRK05995 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB | Back alignment and domain information |
|---|
| >PRK05870 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase | Back alignment and domain information |
|---|
| >PRK08150 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02600 enoyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK07658 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated | Back alignment and domain information |
|---|
| >PRK06495 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06144 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02921 naphthoate synthase | Back alignment and domain information |
|---|
| >PRK08140 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05862 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK09245 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06072 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06494 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06023 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07468 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02267 enoyl-CoA hydratase/isomerase family protein | Back alignment and domain information |
|---|
| >PRK07396 dihydroxynaphthoic acid synthetase; Validated | Back alignment and domain information |
|---|
| >PRK05981 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07260 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase | Back alignment and domain information |
|---|
| >PRK08321 naphthoate synthase; Validated | Back alignment and domain information |
|---|
| >PRK07827 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06210 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08290 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06213 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07659 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06142 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06127 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08260 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit | Back alignment and domain information |
|---|
| >PRK08788 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK07799 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06563 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07657 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase | Back alignment and domain information |
|---|
| >PRK07938 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >COG3904 Predicted periplasmic protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK08252 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >PRK08139 enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK12478 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >PF01343 Peptidase_S49: Peptidase family S49 peptidase classification | Back alignment and domain information |
|---|
| >PRK08272 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ | Back alignment and domain information |
|---|
| >PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional | Back alignment and domain information |
|---|
| >PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PLN02988 3-hydroxyisobutyryl-CoA hydrolase | Back alignment and domain information |
|---|
| >PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated | Back alignment and domain information |
|---|
| >TIGR02437 FadB fatty oxidation complex, alpha subunit FadB | Back alignment and domain information |
|---|
| >PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >PRK08259 enoyl-CoA hydratase; Provisional | Back alignment and domain information |
|---|
| >COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit | Back alignment and domain information |
|---|
| >TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase | Back alignment and domain information |
|---|
| >TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase | Back alignment and domain information |
|---|
| >TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial | Back alignment and domain information |
|---|
| >TIGR03133 malonate_beta malonate decarboxylase, beta subunit | Back alignment and domain information |
|---|
| >PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional | Back alignment and domain information |
|---|
| >PF06833 MdcE: Malonate decarboxylase gamma subunit (MdcE); InterPro: IPR009648 This family consists of several bacterial malonate decarboxylase gamma subunit proteins | Back alignment and domain information |
|---|
| >PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] | Back alignment and domain information |
|---|
| >PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 486 | ||||
| 1tg6_A | 277 | Crystallography And Mutagenesis Point To An Essenti | 9e-68 | ||
| 1tg6_A | 277 | Crystallography And Mutagenesis Point To An Essenti | 1e-15 | ||
| 1tyf_A | 193 | The Structure Of Clpp At 2.3 Angstrom Resolution Su | 8e-47 | ||
| 1tyf_A | 193 | The Structure Of Clpp At 2.3 Angstrom Resolution Su | 8e-08 | ||
| 3mt6_R | 207 | Structure Of Clpp From Escherichia Coli In Complex | 8e-47 | ||
| 3mt6_R | 207 | Structure Of Clpp From Escherichia Coli In Complex | 8e-08 | ||
| 1yg8_A | 193 | The Structure Of A V6a Variant Of Clpp. Length = 19 | 2e-46 | ||
| 1yg8_A | 193 | The Structure Of A V6a Variant Of Clpp. Length = 19 | 2e-07 | ||
| 3hln_A | 193 | Crystal Structure Of Clpp A153c Mutant With Inter-H | 6e-46 | ||
| 3hln_A | 193 | Crystal Structure Of Clpp A153c Mutant With Inter-H | 1e-07 | ||
| 3tt7_A | 197 | Structure Of Clpp From Bacillus Subtilis In Complex | 6e-46 | ||
| 3tt7_A | 197 | Structure Of Clpp From Bacillus Subtilis In Complex | 2e-07 | ||
| 3tt6_A | 196 | Structure Of Clpp From Bacillus Subtilis In Compres | 7e-46 | ||
| 3tt6_A | 196 | Structure Of Clpp From Bacillus Subtilis In Compres | 2e-07 | ||
| 3ktg_A | 199 | Structure Of Clpp From Bacillus Subtilis In Monocli | 8e-46 | ||
| 3ktg_A | 199 | Structure Of Clpp From Bacillus Subtilis In Monocli | 2e-07 | ||
| 3kti_A | 199 | Structure Of Clpp In Complex With Adep1 Length = 19 | 1e-45 | ||
| 3kti_A | 199 | Structure Of Clpp In Complex With Adep1 Length = 19 | 2e-07 | ||
| 3st9_A | 197 | Crystal Structure Of Clpp In Heptameric Form From S | 5e-45 | ||
| 3st9_A | 197 | Crystal Structure Of Clpp In Heptameric Form From S | 9e-07 | ||
| 3qwd_A | 203 | Crystal Structure Of Clpp From Staphylococcus Aureu | 1e-44 | ||
| 3qwd_A | 203 | Crystal Structure Of Clpp From Staphylococcus Aureu | 1e-06 | ||
| 3v5i_A | 203 | The Crystal Structure Of The Mutant Clpp S98a (Stap | 2e-44 | ||
| 3v5i_A | 203 | The Crystal Structure Of The Mutant Clpp S98a (Stap | 1e-06 | ||
| 2zl0_A | 196 | Crystal Structure Of H.Pylori Clpp Length = 196 | 5e-44 | ||
| 2zl0_A | 196 | Crystal Structure Of H.Pylori Clpp Length = 196 | 2e-06 | ||
| 2zl3_A | 196 | Crystal Structure Of H.Pylori Clpp S99a Length = 19 | 1e-43 | ||
| 2zl3_A | 196 | Crystal Structure Of H.Pylori Clpp S99a Length = 19 | 2e-06 | ||
| 3p2l_A | 201 | Crystal Structure Of Atp-Dependent Clp Protease Sub | 2e-36 | ||
| 3p2l_A | 201 | Crystal Structure Of Atp-Dependent Clp Protease Sub | 6e-07 | ||
| 3q7h_A | 195 | Structure Of The Clpp Subunit Of The Atp-Dependent | 3e-35 | ||
| 3q7h_A | 195 | Structure Of The Clpp Subunit Of The Atp-Dependent | 6e-08 | ||
| 1y7o_A | 218 | The Structure Of Streptococcus Pneumoniae A153p Clp | 1e-34 | ||
| 1y7o_A | 218 | The Structure Of Streptococcus Pneumoniae A153p Clp | 2e-09 | ||
| 1y7o_A | 218 | The Structure Of Streptococcus Pneumoniae A153p Clp | 3e-09 | ||
| 2cby_A | 208 | Crystal Structure Of The Atp-Dependent Clp Protease | 2e-27 | ||
| 2cby_A | 208 | Crystal Structure Of The Atp-Dependent Clp Protease | 1e-22 | ||
| 2ce3_A | 200 | Crystal Structure Of The Atp-Dependent Clp Protease | 2e-27 | ||
| 2ce3_A | 200 | Crystal Structure Of The Atp-Dependent Clp Protease | 1e-22 | ||
| 2c8t_A | 206 | The 3.0 A Resolution Structure Of Caseinolytic Clp | 2e-27 | ||
| 2c8t_A | 206 | The 3.0 A Resolution Structure Of Caseinolytic Clp | 2e-22 | ||
| 2f6i_A | 215 | Crystal Structure Of The Clpp Protease Catalytic Do | 3e-20 | ||
| 2f6i_A | 215 | Crystal Structure Of The Clpp Protease Catalytic Do | 2e-19 | ||
| 4hnk_A | 219 | Crystal Structure Of An Enzyme Length = 219 | 2e-17 | ||
| 4gm2_A | 205 | The Crystal Structure Of A Peptidase From Plasmodiu | 1e-16 |
| >pdb|1TG6|A Chain A, Crystallography And Mutagenesis Point To An Essential Role For The N- Terminus Of Human Mitochondrial Clpp Length = 277 | Back alignment and structure |
|
| >pdb|1TG6|A Chain A, Crystallography And Mutagenesis Point To An Essential Role For The N- Terminus Of Human Mitochondrial Clpp Length = 277 | Back alignment and structure |
| >pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests A Model For Atp-Dependent Proteolysis Length = 193 | Back alignment and structure |
| >pdb|1TYF|A Chain A, The Structure Of Clpp At 2.3 Angstrom Resolution Suggests A Model For Atp-Dependent Proteolysis Length = 193 | Back alignment and structure |
| >pdb|3MT6|R Chain R, Structure Of Clpp From Escherichia Coli In Complex With Adep1 Length = 207 | Back alignment and structure |
| >pdb|3MT6|R Chain R, Structure Of Clpp From Escherichia Coli In Complex With Adep1 Length = 207 | Back alignment and structure |
| >pdb|1YG8|A Chain A, The Structure Of A V6a Variant Of Clpp. Length = 193 | Back alignment and structure |
| >pdb|1YG8|A Chain A, The Structure Of A V6a Variant Of Clpp. Length = 193 | Back alignment and structure |
| >pdb|3HLN|A Chain A, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer Disulfide Bonds Length = 193 | Back alignment and structure |
| >pdb|3HLN|A Chain A, Crystal Structure Of Clpp A153c Mutant With Inter-Heptamer Disulfide Bonds Length = 193 | Back alignment and structure |
| >pdb|3TT7|A Chain A, Structure Of Clpp From Bacillus Subtilis In Complex With Dfp Length = 197 | Back alignment and structure |
| >pdb|3TT7|A Chain A, Structure Of Clpp From Bacillus Subtilis In Complex With Dfp Length = 197 | Back alignment and structure |
| >pdb|3TT6|A Chain A, Structure Of Clpp From Bacillus Subtilis In Compressed State Length = 196 | Back alignment and structure |
| >pdb|3TT6|A Chain A, Structure Of Clpp From Bacillus Subtilis In Compressed State Length = 196 | Back alignment and structure |
| >pdb|3KTG|A Chain A, Structure Of Clpp From Bacillus Subtilis In Monoclinic Crystal Form Length = 199 | Back alignment and structure |
| >pdb|3KTG|A Chain A, Structure Of Clpp From Bacillus Subtilis In Monoclinic Crystal Form Length = 199 | Back alignment and structure |
| >pdb|3KTI|A Chain A, Structure Of Clpp In Complex With Adep1 Length = 199 | Back alignment and structure |
| >pdb|3KTI|A Chain A, Structure Of Clpp In Complex With Adep1 Length = 199 | Back alignment and structure |
| >pdb|3ST9|A Chain A, Crystal Structure Of Clpp In Heptameric Form From Staphylococcus Aureus Length = 197 | Back alignment and structure |
| >pdb|3ST9|A Chain A, Crystal Structure Of Clpp In Heptameric Form From Staphylococcus Aureus Length = 197 | Back alignment and structure |
| >pdb|3QWD|A Chain A, Crystal Structure Of Clpp From Staphylococcus Aureus Length = 203 | Back alignment and structure |
| >pdb|3QWD|A Chain A, Crystal Structure Of Clpp From Staphylococcus Aureus Length = 203 | Back alignment and structure |
| >pdb|3V5I|A Chain A, The Crystal Structure Of The Mutant Clpp S98a (Staphylococcus Aureus) Length = 203 | Back alignment and structure |
| >pdb|3V5I|A Chain A, The Crystal Structure Of The Mutant Clpp S98a (Staphylococcus Aureus) Length = 203 | Back alignment and structure |
| >pdb|2ZL0|A Chain A, Crystal Structure Of H.Pylori Clpp Length = 196 | Back alignment and structure |
| >pdb|2ZL0|A Chain A, Crystal Structure Of H.Pylori Clpp Length = 196 | Back alignment and structure |
| >pdb|2ZL3|A Chain A, Crystal Structure Of H.Pylori Clpp S99a Length = 196 | Back alignment and structure |
| >pdb|2ZL3|A Chain A, Crystal Structure Of H.Pylori Clpp S99a Length = 196 | Back alignment and structure |
| >pdb|3P2L|A Chain A, Crystal Structure Of Atp-Dependent Clp Protease Subunit P From Francisella Tularensis Length = 201 | Back alignment and structure |
| >pdb|3P2L|A Chain A, Crystal Structure Of Atp-Dependent Clp Protease Subunit P From Francisella Tularensis Length = 201 | Back alignment and structure |
| >pdb|3Q7H|A Chain A, Structure Of The Clpp Subunit Of The Atp-Dependent Clp Protease From Coxiella Burnetii Length = 195 | Back alignment and structure |
| >pdb|3Q7H|A Chain A, Structure Of The Clpp Subunit Of The Atp-Dependent Clp Protease From Coxiella Burnetii Length = 195 | Back alignment and structure |
| >pdb|1Y7O|A Chain A, The Structure Of Streptococcus Pneumoniae A153p Clpp Length = 218 | Back alignment and structure |
| >pdb|1Y7O|A Chain A, The Structure Of Streptococcus Pneumoniae A153p Clpp Length = 218 | Back alignment and structure |
| >pdb|1Y7O|A Chain A, The Structure Of Streptococcus Pneumoniae A153p Clpp Length = 218 | Back alignment and structure |
| >pdb|2CBY|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 208 | Back alignment and structure |
| >pdb|2CBY|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 208 | Back alignment and structure |
| >pdb|2CE3|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 200 | Back alignment and structure |
| >pdb|2CE3|A Chain A, Crystal Structure Of The Atp-Dependent Clp Protease Proteolytic Subunit 1 (Clpp1) From Mycobacterium Tuberculosis Length = 200 | Back alignment and structure |
| >pdb|2C8T|A Chain A, The 3.0 A Resolution Structure Of Caseinolytic Clp Protease 1 From Mycobacterium Tuberculosis Length = 206 | Back alignment and structure |
| >pdb|2C8T|A Chain A, The 3.0 A Resolution Structure Of Caseinolytic Clp Protease 1 From Mycobacterium Tuberculosis Length = 206 | Back alignment and structure |
| >pdb|2F6I|A Chain A, Crystal Structure Of The Clpp Protease Catalytic Domain From Plasmodium Falciparum Length = 215 | Back alignment and structure |
| >pdb|2F6I|A Chain A, Crystal Structure Of The Clpp Protease Catalytic Domain From Plasmodium Falciparum Length = 215 | Back alignment and structure |
| >pdb|4HNK|A Chain A, Crystal Structure Of An Enzyme Length = 219 | Back alignment and structure |
| >pdb|4GM2|A Chain A, The Crystal Structure Of A Peptidase From Plasmodium Falciparum Length = 205 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 486 | |||
| 1tg6_A | 277 | Putative ATP-dependent CLP protease proteolytic S; | 1e-108 | |
| 1tg6_A | 277 | Putative ATP-dependent CLP protease proteolytic S; | 8e-20 | |
| 3qwd_A | 203 | ATP-dependent CLP protease proteolytic subunit; ca | 1e-106 | |
| 3qwd_A | 203 | ATP-dependent CLP protease proteolytic subunit; ca | 8e-18 | |
| 1yg6_A | 193 | ATP-dependent CLP protease proteolytic subunit; en | 1e-105 | |
| 1yg6_A | 193 | ATP-dependent CLP protease proteolytic subunit; en | 9e-18 | |
| 3p2l_A | 201 | ATP-dependent CLP protease proteolytic subunit; st | 1e-105 | |
| 3p2l_A | 201 | ATP-dependent CLP protease proteolytic subunit; st | 2e-17 | |
| 2f6i_A | 215 | ATP-dependent CLP protease, putative; structural g | 1e-100 | |
| 2f6i_A | 215 | ATP-dependent CLP protease, putative; structural g | 7e-17 | |
| 1y7o_A | 218 | ATP-dependent CLP protease proteolytic subunit; hy | 1e-99 | |
| 1y7o_A | 218 | ATP-dependent CLP protease proteolytic subunit; hy | 1e-17 | |
| 2cby_A | 208 | ATP-dependent CLP protease proteolytic subunit 1; | 5e-95 | |
| 2cby_A | 208 | ATP-dependent CLP protease proteolytic subunit 1; | 1e-11 | |
| 3viv_A | 230 | 441AA long hypothetical NFED protein; protein-pept | 1e-19 | |
| 3viv_A | 230 | 441AA long hypothetical NFED protein; protein-pept | 3e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 |
| >1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Length = 277 | Back alignment and structure |
|---|
Score = 323 bits (829), Expect = e-108
Identities = 135/240 (56%), Positives = 155/240 (64%), Gaps = 58/240 (24%)
Query: 30 HLAKTFHHSATLSRPLVPIVIEQTGRGERAYDIYSRLLRERIICVMGPIDDSLSSVVVAQ 89
L + H +AT + PL+PIV+EQTGRGERAYDIYSRLLRERI+CVMGPIDDS++S+V+AQ
Sbjct: 43 ALQRCLHATATRALPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQ 102
Query: 90 LLFLQSESSKKPIHMYINSPGGSVTSGLGIYDTMQYVLPPIATWCVGQACSMASLLLAAG 149
LLFLQSES+KKPIHMYINSPGG VT+GL IYDTMQY+L PI TWCVGQA SM SLLLAAG
Sbjct: 103 LLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAG 162
Query: 150 EKGMRHSLPNSRIMIHQPSGGVQVGLGIYDTMQYVLPPIATWCVGQACSMASLLLAAGEK 209
GMRHSLPNSRIMIHQPSGG + GQA
Sbjct: 163 TPGMRHSLPNSRIMIHQPSGGAR---------------------GQA------------- 188
Query: 210 GMRHSLPNSRIMIHQPSGGVQGQATDIQIQAEEIINLKKQINGLYVKHTGLSIEKIGKST 269
TDI IQAEEI+ LKKQ+ +Y KHT S++ I +
Sbjct: 189 ------------------------TDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAM 224
|
| >1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Length = 277 | Back alignment and structure |
|---|
| >3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Length = 203 | Back alignment and structure |
|---|
| >3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Length = 203 | Back alignment and structure |
|---|
| >1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Length = 193 | Back alignment and structure |
|---|
| >1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Length = 193 | Back alignment and structure |
|---|
| >3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} Length = 201 | Back alignment and structure |
|---|
| >3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} Length = 201 | Back alignment and structure |
|---|
| >2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Length = 215 | Back alignment and structure |
|---|
| >2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Length = 215 | Back alignment and structure |
|---|
| >1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Length = 218 | Back alignment and structure |
|---|
| >1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Length = 218 | Back alignment and structure |
|---|
| >2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Length = 208 | Back alignment and structure |
|---|
| >2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Length = 208 | Back alignment and structure |
|---|
| >3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Length = 230 | Back alignment and structure |
|---|
| >3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Length = 230 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 486 | |||
| 4gm2_A | 205 | ATP-dependent CLP protease proteolytic subunit; st | 100.0 | |
| 3p2l_A | 201 | ATP-dependent CLP protease proteolytic subunit; st | 100.0 | |
| 3qwd_A | 203 | ATP-dependent CLP protease proteolytic subunit; ca | 100.0 | |
| 1tg6_A | 277 | Putative ATP-dependent CLP protease proteolytic S; | 100.0 | |
| 1yg6_A | 193 | ATP-dependent CLP protease proteolytic subunit; en | 100.0 | |
| 1y7o_A | 218 | ATP-dependent CLP protease proteolytic subunit; hy | 100.0 | |
| 2cby_A | 208 | ATP-dependent CLP protease proteolytic subunit 1; | 100.0 | |
| 2f6i_A | 215 | ATP-dependent CLP protease, putative; structural g | 100.0 | |
| 3viv_A | 230 | 441AA long hypothetical NFED protein; protein-pept | 99.89 | |
| 3bf0_A | 593 | Protease 4; bacterial, hydrolase, inner membrane, | 99.73 | |
| 3rst_A | 240 | Signal peptide peptidase SPPA; alpha/beta protein | 99.62 | |
| 3bf0_A | 593 | Protease 4; bacterial, hydrolase, inner membrane, | 99.52 | |
| 4gm2_A | 205 | ATP-dependent CLP protease proteolytic subunit; st | 99.21 | |
| 3qwd_A | 203 | ATP-dependent CLP protease proteolytic subunit; ca | 98.96 | |
| 3p2l_A | 201 | ATP-dependent CLP protease proteolytic subunit; st | 98.95 | |
| 1tg6_A | 277 | Putative ATP-dependent CLP protease proteolytic S; | 98.85 | |
| 1yg6_A | 193 | ATP-dependent CLP protease proteolytic subunit; en | 98.78 | |
| 2f6i_A | 215 | ATP-dependent CLP protease, putative; structural g | 98.73 | |
| 2cby_A | 208 | ATP-dependent CLP protease proteolytic subunit 1; | 98.68 | |
| 1y7o_A | 218 | ATP-dependent CLP protease proteolytic subunit; hy | 98.61 | |
| 3viv_A | 230 | 441AA long hypothetical NFED protein; protein-pept | 98.36 | |
| 3rst_A | 240 | Signal peptide peptidase SPPA; alpha/beta protein | 97.83 | |
| 2ej5_A | 257 | Enoyl-COA hydratase subunit II; structural genomic | 97.01 | |
| 2pbp_A | 258 | Enoyl-COA hydratase subunit I; B-oxidation, struct | 96.84 | |
| 1sg4_A | 260 | 3,2-trans-enoyl-COA isomerase, mitochondrial; crot | 96.78 | |
| 2uzf_A | 273 | Naphthoate synthase; lyase, menaquinone biosynthes | 96.76 | |
| 3lke_A | 263 | Enoyl-COA hydratase; nysgrc, target 112 structural | 96.71 | |
| 2q35_A | 243 | CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} | 96.48 | |
| 3moy_A | 263 | Probable enoyl-COA hydratase; ssgcid, seattle stru | 96.31 | |
| 3pea_A | 261 | Enoyl-COA hydratase/isomerase family protein; stru | 96.2 | |
| 2a7k_A | 250 | CARB; crotonase, antibiotic, beta-lactam, biosynth | 96.16 | |
| 1mj3_A | 260 | Enoyl-COA hydratase, mitochondrial; homohexamer, l | 96.15 | |
| 2vx2_A | 287 | Enoyl-COA hydratase domain-containing protein 3; i | 96.04 | |
| 3qmj_A | 256 | Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, | 95.98 | |
| 1hzd_A | 272 | AUH, AU-binding protein/enoyl-COA hydratase; RNA-b | 95.95 | |
| 1nzy_A | 269 | Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen | 95.92 | |
| 4di1_A | 277 | Enoyl-COA hydratase ECHA17; structural genomics, s | 95.91 | |
| 1dci_A | 275 | Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg | 95.89 | |
| 1wz8_A | 264 | Enoyl-COA hydratase; lyase, crotonase, hexamer, st | 95.88 | |
| 2ppy_A | 265 | Enoyl-COA hydratase; beta-oxidation, fatty acid me | 95.88 | |
| 2f9y_A | 339 | Acetyl-COA carboxylase, carboxyltransferase alpha; | 95.88 | |
| 1uiy_A | 253 | Enoyl-COA hydratase; lyase, beta-oxidation, croton | 95.87 | |
| 3l3s_A | 263 | Enoyl-COA hydratase/isomerase family protein; crot | 95.87 | |
| 3fdu_A | 266 | Putative enoyl-COA hydratase/isomerase; structural | 95.82 | |
| 4eml_A | 275 | Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe | 95.82 | |
| 3gow_A | 254 | PAAG, probable enoyl-COA hydratase; the spiral fol | 95.82 | |
| 3g64_A | 279 | Putative enoyl-COA hydratase; alpha-beta structure | 95.79 | |
| 2f6q_A | 280 | Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis | 95.74 | |
| 3kqf_A | 265 | Enoyl-COA hydratase/isomerase family protein; IDP0 | 95.72 | |
| 3hrx_A | 254 | Probable enoyl-COA hydratase; the spiral fold, the | 95.71 | |
| 3t89_A | 289 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 95.7 | |
| 3h81_A | 278 | Enoyl-COA hydratase ECHA8; niaid, decode, infectio | 95.62 | |
| 1szo_A | 257 | 6-oxocamphor hydrolase; enzyme-product complex; HE | 95.61 | |
| 3oc7_A | 267 | Enoyl-COA hydratase; seattle structural genomics c | 95.6 | |
| 3i47_A | 268 | Enoyl COA hydratase/isomerase (crotonase); structu | 95.56 | |
| 3rrv_A | 276 | Enoyl-COA hydratase/isomerase; structural genomics | 95.55 | |
| 3he2_A | 264 | Enoyl-COA hydratase ECHA6; fatty acid metabolism, | 95.51 | |
| 3r6h_A | 233 | Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m | 95.45 | |
| 3t8b_A | 334 | 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase | 95.44 | |
| 2f9i_A | 327 | Acetyl-coenzyme A carboxylase carboxyl transferase | 95.43 | |
| 3p5m_A | 255 | Enoyl-COA hydratase/isomerase; seattle structural | 95.32 | |
| 3swx_A | 265 | Probable enoyl-COA hydratase/isomerase; structural | 95.23 | |
| 2bzr_A | 548 | Propionyl-COA carboxylase beta chain 5; fatty acid | 95.18 | |
| 3rsi_A | 265 | Putative enoyl-COA hydratase/isomerase; structural | 95.12 | |
| 2j5i_A | 276 | P-hydroxycinnamoyl COA hydratase/lyase; vanillin, | 95.07 | |
| 1ef8_A | 261 | Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc | 95.05 | |
| 3myb_A | 286 | Enoyl-COA hydratase; ssgcid, struct genomics, seat | 95.03 | |
| 4fzw_C | 274 | 1,2-epoxyphenylacetyl-COA isomerase; structural ge | 95.02 | |
| 3sll_A | 290 | Probable enoyl-COA hydratase/isomerase; structural | 94.96 | |
| 3gkb_A | 287 | Putative enoyl-COA hydratase; structural genomics, | 94.96 | |
| 3h0u_A | 289 | Putative enoyl-COA hydratase; structural genomics, | 94.95 | |
| 3qxz_A | 265 | Enoyl-COA hydratase/isomerase; structural genomics | 94.94 | |
| 3pe8_A | 256 | Enoyl-COA hydratase; emerald biostructures, struct | 94.88 | |
| 3qk8_A | 272 | Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB | 94.82 | |
| 4fzw_A | 258 | 2,3-dehydroadipyl-COA hydratase; structural genomi | 94.72 | |
| 2gtr_A | 261 | CDY-like, chromodomain Y-like protein; structural | 94.6 | |
| 3ot6_A | 232 | Enoyl-COA hydratase/isomerase family protein; stru | 94.46 | |
| 1pjh_A | 280 | Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral | 94.17 | |
| 2fbm_A | 291 | Y chromosome chromodomain protein 1, telomeric IS; | 94.07 | |
| 2j5g_A | 263 | ALR4455 protein; enzyme evolution, C-C bond hydrol | 94.07 | |
| 3zwc_A | 742 | Peroxisomal bifunctional enzyme; beta oxidation pa | 93.71 | |
| 4f47_A | 278 | Enoyl-COA hydratase ECHA19; ssgcid, seattle struct | 93.54 | |
| 2w3p_A | 556 | Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri | 93.47 | |
| 3r9t_A | 267 | ECHA1_1; ssgcid, seattle structural genomics cente | 93.42 | |
| 3qxi_A | 265 | Enoyl-COA hydratase ECHA1; structural genomics, se | 93.42 | |
| 3lao_A | 258 | Enoyl-COA hydratase/isomerase; alpha-beta sandwich | 93.39 | |
| 3trr_A | 256 | Probable enoyl-COA hydratase/isomerase; ssgcid, st | 93.36 | |
| 3njd_A | 333 | Enoyl-COA hydratase; ssgcid, mycobacerium smegmati | 93.36 | |
| 3hin_A | 275 | Putative 3-hydroxybutyryl-COA dehydratase; structu | 93.35 | |
| 3t3w_A | 279 | Enoyl-COA hydratase; ssgcid, structural genomics, | 92.92 | |
| 1vrg_A | 527 | Propionyl-COA carboxylase, beta subunit; TM0716, s | 92.7 | |
| 3qre_A | 298 | Enoyl-COA hydratase, ECHA12_1; structural genomics | 92.45 | |
| 4hdt_A | 353 | 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti | 92.25 | |
| 1on3_A | 523 | Methylmalonyl-COA carboxyltransferase 12S subunit; | 92.23 | |
| 3isa_A | 254 | Putative enoyl-COA hydratase/isomerase; structural | 92.1 | |
| 1x0u_A | 522 | Hypothetical methylmalonyl-COA decarboxylase ALPH; | 91.58 | |
| 3r9q_A | 262 | Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome | 91.53 | |
| 1pix_A | 587 | Glutaconyl-COA decarboxylase A subunit; biotin-dep | 91.34 | |
| 1wdk_A | 715 | Fatty oxidation complex alpha subunit; alpha2BETA2 | 91.18 | |
| 3m6n_A | 305 | RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X | 91.13 | |
| 3iav_A | 530 | Propionyl-COA carboxylase complex B subunit; accas | 91.13 | |
| 3tlf_A | 274 | Enoyl-COA hydratase/isomerase; structural genomics | 90.62 | |
| 3bpt_A | 363 | 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet | 89.9 | |
| 2f9y_B | 304 | Acetyl-coenzyme A carboxylase carboxyl transferas | 89.65 | |
| 3hp0_A | 267 | Putative polyketide biosynthesis enoyl-COA hydrata | 89.12 | |
| 3u9r_B | 555 | MCC beta, methylcrotonyl-COA carboxylase, beta-sub | 87.58 | |
| 2wtb_A | 725 | MFP2, fatty acid multifunctional protein (ATMFP2); | 87.41 | |
| 2f9y_A | 339 | Acetyl-COA carboxylase, carboxyltransferase alpha; | 86.51 | |
| 2f9i_B | 285 | Acetyl-coenzyme A carboxylase carboxyl transferase | 86.34 | |
| 3n6r_B | 531 | Propionyl-COA carboxylase, beta subunit; protein c | 85.99 | |
| 2f9i_A | 327 | Acetyl-coenzyme A carboxylase carboxyl transferase | 84.67 | |
| 3gf3_A | 588 | Glutaconyl-COA decarboxylase subunit A; sodium ION | 82.9 |
| >4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-48 Score=374.37 Aligned_cols=181 Identities=33% Similarity=0.482 Sum_probs=162.4
Q ss_pred cCCCccccchHhhhccCcEEEEccccCcchHHHHHHHHHhhhhcCCCCCeEEEEeCCC----------cccchHHHHHHH
Q psy18232 53 TGRGERAYDIYSRLLRERIICVMGPIDDSLSSVVVAQLLFLQSESSKKPIHMYINSPG----------GSVTSGLGIYDT 122 (486)
Q Consensus 53 ~~~~e~~~Di~s~Ll~~RIIfl~G~I~d~~a~~ii~qLl~L~~ed~~k~I~L~INSPG----------Gsv~aglaIyD~ 122 (486)
.+++++++||||+||++||||++|+|++++++.+++||++|+.+++.++|+||||||| |++++|++|||+
T Consensus 12 ~~~~~~~~di~s~Ll~~Riifl~~~I~d~~a~~iiaqLl~L~~ed~~k~I~lyINSpG~~~~~~~~~~G~v~aglaIyd~ 91 (205)
T 4gm2_A 12 SGRENLYFQGPSLLLSKRIIFLSSPIYPHISEQIISQLLYLEYESKRKPIHLYINSTGDIDNNKIINLNGITDVISIVDV 91 (205)
T ss_dssp ----------CHHHHTTTEEEECSCCCHHHHHHHHHHHHHHHHHCTTCCEEEEEEECTTEETTEESCTTHHHHHHHHHHH
T ss_pred cCCCCCCcCHHHHHhcCCEEEECCEEcHHHHHHHHHHHHHHHhcCCCCCEEEEEeCCCCCCcCCCCCCCCHHHHHHHHHH
Confidence 4678999999999999999999999999999999999999999999999999999999 999999999999
Q ss_pred HhhcCCCceEEEeccchhHHHHHHHcCCCCcccccCCceeEeecCCCccccchhhhccccccCCCeEEEEecccchhhHH
Q psy18232 123 MQYVLPPIATWCVGQACSMASLLLAAGEKGMRHSLPNSRIMIHQPSGGVQVGLGIYDTMQYVLPPIATWCVGQACSMASL 202 (486)
Q Consensus 123 I~~ik~~V~tvv~G~AAS~as~Ia~aGd~~~R~a~~ni~I~INSPGG~v~~glAIyD~L~~~~~kItt~vdGlAAS~As~ 202 (486)
|+++++||+|+|+| +|+|||++
T Consensus 92 m~~~~~~V~t~~~G----------------------------------------------------------~AaS~as~ 113 (205)
T 4gm2_A 92 INYISSDVYTYCLG----------------------------------------------------------KAYGIACI 113 (205)
T ss_dssp HHHSSSCEEEEEEE----------------------------------------------------------EEETHHHH
T ss_pred HHhcCCCEEEEEEe----------------------------------------------------------eehhHHHH
Confidence 99999999999888 66666777
Q ss_pred HHhhcccccccccCCceeeecCCCCCc-cCChHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHHhhhccccccChhhHH
Q psy18232 203 LLAAGEKGMRHSLPNSRIMIHQPSGGV-QGQATDIQIQAEEIINLKKQINGLYVKHTGLSIEKIGKSTVCFYVLHDPYIC 281 (486)
Q Consensus 203 IlaAG~~gkR~m~Pna~iMIHqP~gg~-~G~a~dI~~~Aeel~~~r~~I~~iYA~~TG~s~E~I~~~m~rd~wmsa~e~~ 281 (486)
|++||++|+|+++||+++|||||+++. .|++.|++++++++.++++.+.++|+++||++.|+|+++|+||+||+++
T Consensus 114 il~aG~~gkR~~lP~a~iMIHqP~~~~~~G~a~di~i~a~el~~~~~~i~~iya~~TG~~~e~I~~~m~rd~~msa~--- 190 (205)
T 4gm2_A 114 LASSGKKGYRFSLKNSSFCLNQSYSIIPFNQATNIEIQNKEIMNTKKKVIEIISKNTEKDTNVISNVLERDKYFNAD--- 190 (205)
T ss_dssp HHTTSCTTCEEECTTCEEEECCCCCCCCSSCCSCHHHHHHHHHHHHHHHHHHHHHHHTCCHHHHHHHTTSCEEEEHH---
T ss_pred HHhcCCCCCEEecCCCEEEEecCcccccccCHHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHHHHhcCCcccCHH---
Confidence 777777788999999999999999998 9999999999999999999999999999999999999999999999998
Q ss_pred HHHHHHHHHHhCCcHHHHh
Q psy18232 282 FWINGLYVKHTGLSIEKIG 300 (486)
Q Consensus 282 e~L~~~eAk~~GLiDEiI~ 300 (486)
||+++|++|+++.
T Consensus 191 ------EA~eyGlID~V~~ 203 (205)
T 4gm2_A 191 ------EAVDFKLIDHILE 203 (205)
T ss_dssp ------HHHHTTSCSEECC
T ss_pred ------HHHHcCCccEeec
Confidence 8999999998764
|
| >3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A | Back alignment and structure |
|---|
| >1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A | Back alignment and structure |
|---|
| >1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A | Back alignment and structure |
|---|
| >2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A | Back alignment and structure |
|---|
| >3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A | Back alignment and structure |
|---|
| >3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A | Back alignment and structure |
|---|
| >4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A | Back alignment and structure |
|---|
| >3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A | Back alignment and structure |
|---|
| >3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A | Back alignment and structure |
|---|
| >2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A | Back alignment and structure |
|---|
| >1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 | Back alignment and structure |
|---|
| >3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A | Back alignment and structure |
|---|
| >3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A | Back alignment and structure |
|---|
| >1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A | Back alignment and structure |
|---|
| >2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A | Back alignment and structure |
|---|
| >3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* | Back alignment and structure |
|---|
| >1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* | Back alignment and structure |
|---|
| >2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A | Back alignment and structure |
|---|
| >1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* | Back alignment and structure |
|---|
| >4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A | Back alignment and structure |
|---|
| >1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 | Back alignment and structure |
|---|
| >1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} | Back alignment and structure |
|---|
| >4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} | Back alignment and structure |
|---|
| >3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} | Back alignment and structure |
|---|
| >2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A | Back alignment and structure |
|---|
| >3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* | Back alignment and structure |
|---|
| >1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A | Back alignment and structure |
|---|
| >3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* | Back alignment and structure |
|---|
| >3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A | Back alignment and structure |
|---|
| >2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A | Back alignment and structure |
|---|
| >3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* | Back alignment and structure |
|---|
| >1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* | Back alignment and structure |
|---|
| >3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A | Back alignment and structure |
|---|
| >3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A | Back alignment and structure |
|---|
| >4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} | Back alignment and structure |
|---|
| >2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A | Back alignment and structure |
|---|
| >3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A | Back alignment and structure |
|---|
| >2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 | Back alignment and structure |
|---|
| >2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D | Back alignment and structure |
|---|
| >3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* | Back alignment and structure |
|---|
| >4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A | Back alignment and structure |
|---|
| >3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A | Back alignment and structure |
|---|
| >3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A | Back alignment and structure |
|---|
| >1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} | Back alignment and structure |
|---|
| >4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* | Back alignment and structure |
|---|
| >3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A | Back alignment and structure |
|---|
| >1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 | Back alignment and structure |
|---|
| >1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* | Back alignment and structure |
|---|
| >3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A | Back alignment and structure |
|---|
| >3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A | Back alignment and structure |
|---|
| >3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 | Back alignment and structure |
|---|
| >3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 | Back alignment and structure |
|---|
| >3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B | Back alignment and structure |
|---|
| >2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 | Back alignment and structure |
|---|
| >2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} | Back alignment and structure |
|---|
| >2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 486 | ||||
| d1tg6a1 | 193 | c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Hum | 1e-56 | |
| d1tg6a1 | 193 | c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Hum | 6e-16 | |
| d1yg6a1 | 183 | c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Es | 1e-54 | |
| d1yg6a1 | 183 | c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Es | 3e-08 | |
| d1y7oa1 | 192 | c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Str | 9e-44 | |
| d1y7oa1 | 192 | c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Str | 4e-18 | |
| d1y7oa1 | 192 | c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Str | 2e-13 | |
| d2cbya1 | 179 | c.14.1.1 (A:15-193) Clp protease, ClpP subunit {My | 3e-40 | |
| d2cbya1 | 179 | c.14.1.1 (A:15-193) Clp protease, ClpP subunit {My | 9e-24 | |
| d2f6ia1 | 190 | c.14.1.1 (A:177-366) Clp protease, ClpP subunit {P | 6e-31 |
| >d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 193 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: ClpP/crotonase superfamily: ClpP/crotonase family: Clp protease, ClpP subunit domain: Clp protease, ClpP subunit species: Human (Homo sapiens), mitochondrial [TaxId: 9606]
Score = 184 bits (469), Expect = 1e-56
Identities = 131/226 (57%), Positives = 148/226 (65%), Gaps = 58/226 (25%)
Query: 44 PLVPIVIEQTGRGERAYDIYSRLLRERIICVMGPIDDSLSSVVVAQLLFLQSESSKKPIH 103
PL+PIV+EQTGRGERAYDIYSRLLRERI+CVMGPIDDS++S+V+AQLLFLQSES+KKPIH
Sbjct: 1 PLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIH 60
Query: 104 MYINSPGGSVTSGLGIYDTMQYVLPPIATWCVGQACSMASLLLAAGEKGMRHSLPNSRIM 163
MYINSPGG VT+GL IYDTMQY+L PI TWCVGQA SM SLLLAAG GMRHSLPNSRIM
Sbjct: 61 MYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIM 120
Query: 164 IHQPSGGVQVGLGIYDTMQYVLPPIATWCVGQACSMASLLLAAGEKGMRHSLPNSRIMIH 223
IHQPSGG + GQA
Sbjct: 121 IHQPSGGAR---------------------GQA--------------------------- 132
Query: 224 QPSGGVQGQATDIQIQAEEIINLKKQINGLYVKHTGLSIEKIGKST 269
TDI IQAEEI+ LKKQ+ +Y KHT S++ I +
Sbjct: 133 ----------TDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAM 168
|
| >d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 193 | Back information, alignment and structure |
|---|
| >d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Length = 183 | Back information, alignment and structure |
|---|
| >d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Length = 183 | Back information, alignment and structure |
|---|
| >d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Length = 192 | Back information, alignment and structure |
|---|
| >d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Length = 192 | Back information, alignment and structure |
|---|
| >d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Length = 192 | Back information, alignment and structure |
|---|
| >d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 | Back information, alignment and structure |
|---|
| >d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 | Back information, alignment and structure |
|---|
| >d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Length = 190 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 486 | |||
| d1tg6a1 | 193 | Clp protease, ClpP subunit {Human (Homo sapiens), | 100.0 | |
| d1y7oa1 | 192 | Clp protease, ClpP subunit {Streptococcus pneumoni | 100.0 | |
| d1yg6a1 | 183 | Clp protease, ClpP subunit {Escherichia coli [TaxI | 100.0 | |
| d2cbya1 | 179 | Clp protease, ClpP subunit {Mycobacterium tubercul | 100.0 | |
| d2f6ia1 | 190 | Clp protease, ClpP subunit {Plasmodium falciparum | 100.0 | |
| d1tg6a1 | 193 | Clp protease, ClpP subunit {Human (Homo sapiens), | 99.13 | |
| d1y7oa1 | 192 | Clp protease, ClpP subunit {Streptococcus pneumoni | 99.12 | |
| d2cbya1 | 179 | Clp protease, ClpP subunit {Mycobacterium tubercul | 99.11 | |
| d2f6ia1 | 190 | Clp protease, ClpP subunit {Plasmodium falciparum | 99.04 | |
| d1yg6a1 | 183 | Clp protease, ClpP subunit {Escherichia coli [TaxI | 98.98 | |
| d2f9ya1 | 316 | Acetyl-coenzyme A carboxylase carboxyl transferase | 95.9 | |
| d1hzda_ | 266 | AUH protein {Human (Homo sapiens) [TaxId: 9606]} | 95.74 | |
| d1dcia_ | 275 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 95.56 | |
| d1nzya_ | 269 | 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., | 95.45 | |
| d1q52a_ | 297 | Naphthoate synthase MenB {Mycobacterium tuberculos | 95.02 | |
| d1mj3a_ | 260 | Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve | 95.01 | |
| d1wz8a1 | 263 | Probable enoyl-CoA hydratase TTHA0218 {Thermus the | 94.9 | |
| d2f6qa1 | 245 | Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( | 94.78 | |
| d2a7ka1 | 230 | Carbapenem biosynthes protein CarB {Pectobacterium | 94.47 | |
| d1wdka4 | 310 | Fatty oxidation complex alpha subunit, N-terminal | 94.13 | |
| d1pixa3 | 299 | Glutaconyl-CoA decarboxylase A subunit {Acidaminoc | 93.86 | |
| d1vrga2 | 264 | Propionyl-CoA carboxylase complex B subunit, PccB | 93.66 | |
| d1pjha_ | 266 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 93.65 | |
| d1uiya_ | 253 | Enoyl-CoA hydratase (crotonase) {Thermus thermophi | 93.62 | |
| d1on3a2 | 264 | Methylmalonyl-CoA carboxyltransferase (transcarbox | 93.54 | |
| d1ef8a_ | 261 | Methylmalonyl CoA decarboxylase {Escherichia coli | 93.09 | |
| d2fw2a1 | 258 | Chromodomain protein CDY2A {Human (Homo sapiens) [ | 93.04 | |
| d1sg4a1 | 249 | Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso | 92.19 | |
| d1szoa_ | 249 | 6-oxo camphor hydrolase {Rhodococcus erythropolis | 90.07 | |
| d1xnya2 | 263 | Propionyl-CoA carboxylase complex B subunit, PccB | 87.13 | |
| d1pixa2 | 287 | Glutaconyl-CoA decarboxylase A subunit {Acidaminoc | 86.71 | |
| d2a7sa2 | 271 | Propionyl-CoA carboxylase complex B subunit, PccB | 83.64 |
| >d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: ClpP/crotonase superfamily: ClpP/crotonase family: Clp protease, ClpP subunit domain: Clp protease, ClpP subunit species: Human (Homo sapiens), mitochondrial [TaxId: 9606]
Probab=100.00 E-value=3.8e-49 Score=371.91 Aligned_cols=191 Identities=69% Similarity=1.062 Sum_probs=172.9
Q ss_pred CCcceeecccCCCccccchHhhhccCcEEEEccccCcchHHHHHHHHHhhhhcCCCCCeEEEEeCCCcccchHHHHHHHH
Q psy18232 44 PLVPIVIEQTGRGERAYDIYSRLLRERIICVMGPIDDSLSSVVVAQLLFLQSESSKKPIHMYINSPGGSVTSGLGIYDTM 123 (486)
Q Consensus 44 ~~vP~v~~~~~~~e~~~Di~s~Ll~~RIIfl~G~I~d~~a~~ii~qLl~L~~ed~~k~I~L~INSPGGsv~aglaIyD~I 123 (486)
|++|+|+|++++||+++||||+||++||||++|+|++++++.++++|++|+.+++.++|+|+||||||++++|++|||+|
T Consensus 1 p~~p~~~~~~~~~~~~~Di~s~l~~~Riifl~g~I~~~~~~~~i~~l~~l~~~~~~~~I~l~InS~GG~v~~g~~i~d~i 80 (193)
T d1tg6a1 1 PLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTM 80 (193)
T ss_dssp CCCCBCC---------CBHHHHHHTTTEEEEESSBCHHHHHHHHHHHHHHHHHCSSSCEEEEEEECCBCHHHHHHHHHHH
T ss_pred CCCCEEEeecCCCchhhhHhHHHhccCEEEECCEEchHHHHHHHHHHHHhcccCCCcEEEEEeecCcccHHHHHHHHHHH
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hhcCCCceEEEeccchhHHHHHHHcCCCCcccccCCceeEeecCCCccccchhhhccccccCCCeEEEEecccchhhHHH
Q psy18232 124 QYVLPPIATWCVGQACSMASLLLAAGEKGMRHSLPNSRIMIHQPSGGVQVGLGIYDTMQYVLPPIATWCVGQACSMASLL 203 (486)
Q Consensus 124 ~~ik~~V~tvv~G~AAS~as~Ia~aGd~~~R~a~~ni~I~INSPGG~v~~glAIyD~L~~~~~kItt~vdGlAAS~As~I 203 (486)
+.++.+|+|+|.| +|+|||++|
T Consensus 81 ~~~~~~V~tv~~G----------------------------------------------------------~aaS~a~~i 102 (193)
T d1tg6a1 81 QYILNPICTWCVG----------------------------------------------------------QAASMGSLL 102 (193)
T ss_dssp HHSCSCEEEEEEE----------------------------------------------------------EEETHHHHH
T ss_pred HhhcCceEEEEcc----------------------------------------------------------chHHHHHHH
Confidence 9999999999888 666667777
Q ss_pred HhhcccccccccCCceeeecCCCCCccCChHHHHHHHHHHHHHHHHHHHHHHHHhCCCHHHHHhhhccccccChhhHHHH
Q psy18232 204 LAAGEKGMRHSLPNSRIMIHQPSGGVQGQATDIQIQAEEIINLKKQINGLYVKHTGLSIEKIGKSTVCFYVLHDPYICFW 283 (486)
Q Consensus 204 laAG~~gkR~m~Pna~iMIHqP~gg~~G~a~dI~~~Aeel~~~r~~I~~iYA~~TG~s~E~I~~~m~rd~wmsa~e~~e~ 283 (486)
++||++++|++.|||++|+|||+++..|++.|+..++++++++++++.++|+++||++.+++++++++|+||+++
T Consensus 103 l~aG~~g~R~~~pns~~miHq~~~~~~G~~~di~~~~~el~~~~~~i~~i~a~~Tg~~~~~i~~~~~rD~~lta~----- 177 (193)
T d1tg6a1 103 LAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPM----- 177 (193)
T ss_dssp HHTSCTTCEEECTTCEEEECCCCCCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHSSCEEECHH-----
T ss_pred hhcCccCccccCcccHHHhcCCccCCCcCHHHHHHHHHHHHHHHHHHHHHHHHHcCCCHHHHHHHhccCccCCHH-----
Confidence 777777889999999999999999999999999999999999999999999999999999999999999999998
Q ss_pred HHHHHHHHhCCcHHHHhh
Q psy18232 284 INGLYVKHTGLSIEKIGK 301 (486)
Q Consensus 284 L~~~eAk~~GLiDEiI~~ 301 (486)
||+++|++|+++.+
T Consensus 178 ----EAl~yGliD~Ii~~ 191 (193)
T d1tg6a1 178 ----EAQEFGILDKVLVH 191 (193)
T ss_dssp ----HHHHHTSCSEECSS
T ss_pred ----HHHHcCCCCEEccC
Confidence 89999999988764
|
| >d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} | Back information, alignment and structure |
|---|
| >d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} | Back information, alignment and structure |
|---|
| >d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} | Back information, alignment and structure |
|---|
| >d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} | Back information, alignment and structure |
|---|
| >d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|