Diaphorina citri psyllid: psy18237

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050

QDTAWLPTFINVTTLTNVTSTNEYVTGDNVITRWVTLTLDGRVETQNPLRSIPIDVTFHVDFPEQDTAWLPTFTNVTTLTNVTSTNEYVTGDNVITRWCVCDEGFRGDGYSCEDIDECTDNTNYCDYILLCGSKPGEFMNPMTNKTEEIDECNLMPNMCNHGTCMNTPGSFHCQCNRGFLYDSDTHQCIDINECEEMPEICGSGTYINECEEMPEICGSGTCENNIGSFSCRYINECEEMPEICGSGTCENNIGSFSCRCEDGYSVKPAEGPACTDENECTMRTHNCDDNADCINNPVNKTGTRCVDIDECATSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECIDMRRELCYLNYTDGLCSLPMSNEQTRMVCCCSMGQSWGKPCQPCPPPGSRDYILLCGKDFAKLCPEGVGRGDKGEDLNECRTVITVRDSYFTEQWRDAKKNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQTCEDINECLELSNQCAFRCHNISMSVSNSLACALTPVLTRKISMSVSNSLACALTPVLTRKVATPVAVINDCIDLDECRMMSYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDECKEVNKRESRCYLDTEEEEEEEEEEEGGYGGGSRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEHKTLCPGGSGYRPNSATREGICPSPGKCQNVMGSFICTCPPGYRLSPDKNSCQEDFAKLCPEGVGRGDKGEDLNECALMPSACQGGECINTDGSYRCECPAGYVKDETGKICIDDNECLSIPNICGNGTCTNLNGGFECTCSEGYAPGPLGSCAILLTLPPISPSTDIDECYERPGICANGDCANFQGSFQCTCANGYTLNTARDSCVDIDECARHPNICNNGTCVNAIGSFKCHCYAGFKLSHNNDCIGNCTDINECESPQACLYGNCTNTLGSNCTDINECESPQACLYGNCTNTLGSFSCTCPPNYQLTPAGNACVVLEDINECEEHDNICENGHCTNTFGSFMCSCQDGFKL

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccECcccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccEEEccccccccccccccCCccccccccccccccEEEcccccEEEEcccccECcccccccccccccccccccccccEEEccccccEEccccccCCccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccEEECccccEEEEcccccECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEECccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccEEECccccEEEEcccccCCcccccccccccccccccccccccEEEcccccEEEEcccccCCcccccccccccccccccccccccccEECccccccccccccccccccccccEEECccccEEEEcccccCCccccccccccccccccccccccccccEEECccccEEEEccccccc

*DTAWLPTFINVTTLTNVTSTNEYVTGDNVITRWVTLTLDGRVETQNPLRSIPIDVTFHVDFPEQDTAWLPTFTNVTTLTNVTSTNEYVTGDNVITRWCVCDEGFRGDGYSCEDIDECTDNTNYCDYILLCGSKPGEFMNPMTNKTEEIDECNLMPNMCNHGTCMNTPGSFHCQCNRGFLYDSDTHQCIDINECEEMPEICGSGTYINECEEMPEICGSGTCENNIGSFSCRYINECEEMPEICGSGTCENNIGSFSCRCEDGYSVKPAEGPACTDENECTMRTHNCDDNADCINNPVNKTGTRCVDIDECATSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECIDMRRELCYLNYTDGLCSLPMSNEQTRMVCCCSMGQSWGKPCQPCPPPGSRDYILLCGKDFAKLCPEGVGRGDKGEDLNECRTVITVRDSYFTEQWRDAKKNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQTCEDINECLELSNQCAFRCHNISMSVSNSLACALTPVLTRKISMSVSNSLACALTPVLTRKVATPVAVINDCIDLDECRMMSYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDECKEVNKRESRCYLDTEEEEEEEEEEEGGYGGGSRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEHKTLCPGGSGYRPNSATREGICPSPGKCQNVMGSFICTCPPGYRLSPDKNSCQEDFAKLCPEGVGRGDKGEDLNECALMPSACQGGECINTDGSYRCECPAGYVKDETGKICIDDNECLSIPNICGNGTCTNLNGGFECTCSEGYAPGPLGSCAILLTLPPISPSTDIDECYERPGICANGDCANFQGSFQCTCANGYTLNTARDSCVDIDECARHPNICNNGTCVNAIGSFKCHCYAGFKLSHNNDCIGNCTDINECESPQACLYGNCTNTLGSNCTDINECESPQACLYGNCTNTLGSFSCTCPPNYQLTPAGNACVVLEDINECEEHDNICENGHCTNTFGSFMCSCQDGFKL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

QDTAWLPTFINVTTLTNVTSTNEYVTGDNVITRWVTLTLDGRVETQNPLRSIPIDVTFHVDFPEQDTAWLPTFTNVTTLTNVTSTNEYVTGDNVITRWCVCDEGFRGDGYSCEDIDECTDNTNYCDYILLCGSKPGEFMNPMTNKTEEIDECNLMPNMCNHGTCMNTPGSFHCQCNRGFLYDSDTHQCIDINECEEMPEICGSGTYINECEEMPEICGSGTCENNIGSFSCRYINECEEMPEICGSGTCENNIGSFSCRCEDGYSVKPAEGPACTDENECTMRTHNCDDNADCINNPVNKTGTRCVDIDECATSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECIDMRRELCYLNYTDGLCSLPMSNEQTRMVCCCSMGQSWGKPCQPCPPPGSRDYILLCGKDFAKLCPEGVGRGDKGEDLNECRTVITVRDSYFTEQWRDAKKNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQTCEDINECLELSNQCAFRCHNISMSVSNSLACALTPVLTRKISMSVSNSLACALTPVLTRKVATPVAVINDCIDLDECRMMSYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDECKEVNxxxxxxxxxxxxxxxxxxxxxGGYGGGSRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEHKTLCPGGSGYRPNSATREGICPSPGKCQNVMGSFICTCPPGYRLSPDKNSCQEDFAKLCPEGVGRGDKGEDLNECALMPSACQGGECINTDGSYRCECPAGYVKDETGKICIDDNECLSIPNICGNGTCTNLNGGFECTCSEGYAPGPLGSCAILLTLPPISPSTDIDECYERPGICANGDCANFQGSFQCTCANGYTLNTARDSCVDIDECARHPNICNNGTCVNAIGSFKCHCYAGFKLSHNNDCIGNCTDINECESPQACLYGNCTNTLGSNCTDINECESPQACLYGNCTNTLGSFSCTCPPNYQLTPAGNACVVLEDINECEEHDNICENGHCTNTFGSFMCSCQDGFKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0003674 [MF]	molecular_function	probable
GO:0008150 [BP]	biological_process	probable
GO:0044420 [CC]	extracellular matrix part	probable	GO:0005575, GO:0031012
GO:0005578 [CC]	proteinaceous extracellular matrix	probable	GO:0005575, GO:0005576, GO:0044421, GO:0031012
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UZK, chain A
Confidence level:very confident
Coverage over the Query: 575-626,659-688,718-747,766-807
View the alignment between query and template
View the model in PyMOL

Template: 1UZK, chain A
Confidence level:very confident
Coverage over the Query: 306-415,437-493
View the alignment between query and template
View the model in PyMOL

Template: 1EMN, chain A
Confidence level:very confident
Coverage over the Query: 231-267,302-347
View the alignment between query and template
View the model in PyMOL

Template: 1EMN, chain A
Confidence level:very confident
Coverage over the Query: 971-1037
View the alignment between query and template
View the model in PyMOL

Template: 1Z6C, chain A
Confidence level:very confident
Coverage over the Query: 147-196,242-277
View the alignment between query and template
View the model in PyMOL

Template: 2VJ3, chain A
Confidence level:very confident
Coverage over the Query: 860-943,972-1019
View the alignment between query and template
View the model in PyMOL

Template: 1Z1Y, chain A
Confidence level:very confident
Coverage over the Query: 774-843,857-937
View the alignment between query and template
View the model in PyMOL

Template: 2W2N, chain E
Confidence level:very confident
Coverage over the Query: 71-114
View the alignment between query and template
View the model in PyMOL

Template: 1YO8, chain A
Confidence level:very confident
Coverage over the Query: 78-128,162-195,226-291,315-348
View the alignment between query and template
View the model in PyMOL

Template: 1APJ, chain A
Confidence level:very confident
Coverage over the Query: 656-709
View the alignment between query and template
View the model in PyMOL

Template: 3M0C, chain C
Confidence level:very confident
Coverage over the Query: 194-267,301-352
View the alignment between query and template
View the model in PyMOL

Template: 3FCS, chain B
Confidence level:confident
Coverage over the Query: 448-489,502-524,543-629,642-699,713-741
View the alignment between query and template
View the model in PyMOL

Template: 1UZJ, chain A
Confidence level:probable
Coverage over the Query: 576-641,654-747
View the alignment between query and template
View the model in PyMOL

Template: 1KLO, chain A
Confidence level:probable
Coverage over the Query: 454-542,554-617
View the alignment between query and template
View the model in PyMOL

Template: 1KLO, chain A
Confidence level:probable
Coverage over the Query: 586-688,703-742
View the alignment between query and template
View the model in PyMOL