Psyllid ID: psy18237

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050
QDTAWLPTFINVTTLTNVTSTNEYVTGDNVITRWVTLTLDGRVETQNPLRSIPIDVTFHVDFPEQDTAWLPTFTNVTTLTNVTSTNEYVTGDNVITRWCVCDEGFRGDGYSCEDIDECTDNTNYCDYILLCGSKPGEFMNPMTNKTEEIDECNLMPNMCNHGTCMNTPGSFHCQCNRGFLYDSDTHQCIDINECEEMPEICGSGTYINECEEMPEICGSGTCENNIGSFSCRYINECEEMPEICGSGTCENNIGSFSCRCEDGYSVKPAEGPACTDENECTMRTHNCDDNADCINNPVNKTGTRCVDIDECATSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECIDMRRELCYLNYTDGLCSLPMSNEQTRMVCCCSMGQSWGKPCQPCPPPGSRDYILLCGKDFAKLCPEGVGRGDKGEDLNECRTVITVRDSYFTEQWRDAKKNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQTCEDINECLELSNQCAFRCHNISMSVSNSLACALTPVLTRKISMSVSNSLACALTPVLTRKVATPVAVINDCIDLDECRMMSYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDECKEVNKRESRCYLDTEEEEEEEEEEEGGYGGGSRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEHKTLCPGGSGYRPNSATREGICPSPGKCQNVMGSFICTCPPGYRLSPDKNSCQEDFAKLCPEGVGRGDKGEDLNECALMPSACQGGECINTDGSYRCECPAGYVKDETGKICIDDNECLSIPNICGNGTCTNLNGGFECTCSEGYAPGPLGSCAILLTLPPISPSTDIDECYERPGICANGDCANFQGSFQCTCANGYTLNTARDSCVDIDECARHPNICNNGTCVNAIGSFKCHCYAGFKLSHNNDCIGNCTDINECESPQACLYGNCTNTLGSNCTDINECESPQACLYGNCTNTLGSFSCTCPPNYQLTPAGNACVVLEDINECEEHDNICENGHCTNTFGSFMCSCQDGFKL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccEEEccccccccccccccEEccccccccccccccEEEcccccEEEEcccccEEcccccccccccccccccccccccEEEccccccEEccccccEEccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccEEEEccccEEEEcccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccEEEEccccEEEEcccccEEcccccccccccccccccccccccEEEcccccEEEEcccccEEcccccccccccccccccccccccccEEEccccccccccccccccccccccEEEEccccEEEEcccccEEccccccccccccccccccccccccccEEEEccccEEEEccccccc
ccccEcccccccEEEccccccccccccccccccccccccccccccccccccccccccEccccccccccccccccccccccccccccccEEEcccccEEEEccccccccccEccccccccccccccccccEEEccccccccccccccccccccccccccccccEEEcccccEEEEcccccEccccccEEccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccccccEEccccccccccccccccHcccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccEEEcccccEEEEcccccEccccccEEEcccccccccccccccEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEccccccccccccccccccEcccccccccccccccccHcccccccccccEEEcccccEEEEcccccEccccccEEEEccccccccccccccEEEcccccEEEEcccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEccccccccccccEcccccccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccEEEcccccEEEEccccccccccccccEEcccccccccccccccccEEEcccccEEEEccccccc
qdtawlptfinvttltnvtstneyvtgdnvITRWVTLTLDgrvetqnplrsipidvtfhvdfpeqdtawlptftnvttltnvtstneyvtgdnvitrwcvcdegfrgdgyscedidectdntnycDYILlcgskpgefmnpmtnkteeidecnlmpnmcnhgtcmntpgsfhcqcnrgflydsdthqcidineceempeicgsgtyineceempeicgsgtcennigsfscryineceempeicgsgtcennigsfscrcedgysvkpaegpactdenectmrthncddnadcinnpvnktgtrcvdidecatsiqrcgegfcvndvgtyhcvcpdgymllpsgkeCIDMRRELCYLNytdglcslpmsneqtRMVCCcsmgqswgkpcqpcpppgsrdyiLLCGKDFaklcpegvgrgdkgedlnecRTVITVRDSYFTEQWRDakknqrlgfcyrsltngrcvlptgpalLMEVTRMdccctmgmawgpqcqlcptrgsqtceDINECLelsnqcafrchnismsvsnslacaltpvltrkISMSVSNSlacaltpvltrkvatpvavindcidldecrmmsylcrngrcrnnigsffceclqgytlasegqycrdvdeckevnkresrcyldteeeeeeeeeeeggygggsrrvtctkeiagsttrstcccsigkawgpqceecpavgsdehktlcpggsgyrpnsatregicpspgkcqnvmgsfictcppgyrlspdknscqedfaklcpegvgrgdkgedlnecalmpsacqggecintdgsyrcecpagyvkdetgkiciddneclsipnicgngtctnlnggfectcsegyapgplgscailltlppispstdidecyerpgicangdcanfqgsfqctcangytlntardscvdidecarhpnicnngtcvnaigsfkchcyagfklshnndcignctdinecespqaclygnctntlgsnctdinecespqaclygnctntlgsfsctcppnyqltpagnaCVVLEDineceehdnicenghctntfgsfmcscqdgfkl
qdtawlptfinvttltnvtstneyvtgdnviTRWVTLTLDGRVETQNPLRSIPIDVTFHVDFPEQDTAWLPTFTNVTtltnvtstneyvtgdnvitRWCVCDEGFRGDGYSCEDIDECTDNTNYCDYILLCGSKPGEFMNPMTNKTEEIDECNLMPNMCNHGTCMNTPGSFHCQCNRGFLYDSDTHQCIDINECEEMPEICGSGTYINECEEMPEICGSGTCENNIGSFSCRYINECEEMPEICGSGTCENNIGSFSCRCEDGYSVKPAEGPACTDENECTMRTHNCDDNADCINNPVNKTGTRCVDIDECATSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECIDMRRELCYLNYTDGLCSLPMSNEQTRMVCCCSMGQSWGKPCQPCPPPGSRDYILLCGKDFAKLCPEgvgrgdkgedlnecRTVITvrdsyfteqwrdakknqrlgfcyrsltngrcvlPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQTCEDINECLELSNQCAFRCHNISMSVSNSLACALTPVLTRKISMSVSNSLACALTpvltrkvatpvavINDCIDLDECRMMSYLCRNGRCRNNIGSFFCECLQGYTlasegqycrdvdeckevnkresrcyldteeeeeeeeeeeggygggsrrvTCTKEiagsttrstcCCSIGKAWGPQCEECPAVGSDEHKTLCPGGSGYRPNSATREGICPSPGKCQNVMGSFICTCPPGYRLSPDKNSCQEDFAKLCPEGVGRGDKGEDLNECALMPSACQGGECINTDGSYRCECPAGYVKDETGKICIDDNECLSIPNICGNGTCTNLNGGFECTCSEGYAPGPLGSCAILLTLPPISPSTDIDECYERPGICANGDCANFQGSFQCTCANGYTLNTARDSCVDIDECARHPNICNNGTCVNAIGSFKCHCYAGFKLSHNNDCIGNCTDINECESPQACLYGNCTNTLGSNCTDINECESPQACLYGNCTNTLGSFSCTCPPNYQLTPAGNACVVLEDINECEEHDNICENGHCTNTFGSFMCSCQDGFKL
QDTAWLPTFInvttltnvtstnEYVTGDNVITRWVTLTLDGRVETQNPLRSIPIDVTFHVDFPEQDTAWLPtftnvttltnvtstnEYVTGDNVITRWCVCDEGFRGDGYSCEDIDECTDNTNYCDYILLCGSKPGEFMNPMTNKTEEIDECNLMPNMCNHGTCMNTPGSFHCQCNRGFLYDSDTHQCIDINECEEMPEICGSGTYINECEEMPEICGSGTCENNIGSFSCRYINECEEMPEICGSGTCENNIGSFSCRCEDGYSVKPAEGPACTDENECTMRTHNCDDNADCINNPVNKTGTRCVDIDECATSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECIDMRRELCYLNYTDGLCSLPMSNEQTRMVCCCSMGQSWGKPCQPCPPPGSRDYILLCGKDFAKLCPEGVGRGDKGEDLNECRTVITVRDSYFTEQWRDAKKNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQTCEDINECLELSNQCAFRCHNISMSVSNSLACALTPVLTRKISMSVSNSLACALTPVLTRKVATPVAVINDCIDLDECRMMSYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDECKEVNKRESRCYLDTeeeeeeeeeeeggygggSRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEHKTLCPGGSGYRPNSATREGICPSPGKCQNVMGSFICTCPPGYRLSPDKNSCQEDFAKLCPEGVGRGDKGEDLNECALMPSACQGGECINTDGSYRCECPAGYVKDETGKICIDDNECLSIPnicgngtctnlnggFECTCSEGYAPGPLGSCAILLTLPPISPSTDIDECYERPGICANGDCANFQGSFQCTCANGYTLNTARDSCVDIDECARHPNICNNGTCVNAIGSFKCHCYAGFKLSHNNDCIGNCTDINECESPQACLYGNCTNTLGSNCTDINECESPQACLYGNCTNTLGSFSCTCPPNYQLTPAGNACVVLEDINECEEHDNICENGHCTNTFGSFMCSCQDGFKL
***AWLPTFINVTTLTNVTSTNEYVTGDNVITRWVTLTLDGRVETQNPLRSIPIDVTFHVDFPEQDTAWLPTFTNVTTLTNVTSTNEYVTGDNVITRWCVCDEGFRGDGYSCEDIDECTDNTNYCDYILLCGSKPGEFMN*****TEEIDECNLMPNMCNHGTCMNTPGSFHCQCNRGFLYDSDTHQCIDINECEEMPEICGSGTYINECEEMPEICGSGTCENNIGSFSCRYINECEEMPEICGSGTCENNIGSFSCRCEDGYSVKPAEGPACTDENECTMRTHNCDDNADCINNPVNKTGTRCVDIDECATSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECIDMRRELCYLNYTDGLCSLPMSNEQTRMVCCCSMGQSWGKPCQPCPPPGSRDYILLCGKDFAKLCPEGVGRGDKGEDLNECRTVITVRDSYFTEQWRDAKKNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQTCEDINECLELSNQCAFRCHNISMSVSNSLACALTPVLTRKISMSVSNSLACALTPVLTRKVATPVAVINDCIDLDECRMMSYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDECKE*********************************TCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVG***********************ICPSPGKCQNVMGSFICTCPPGYRLS*****CQEDFAKLCPEGV*******DLNECALMPSACQGGECINTDGSYRCECPAGYVKDETGKICIDDNECLSIPNICGNGTCTNLNGGFECTCS************ILLTLPPISPSTDIDECYERPGICANGDCANFQGSFQCTCANGYTLNTARDSCVDIDECARHPNICNNGTCVNAIGSFKCHCYAGFKLSHNNDCIGNCTDINECESPQACLYGNCTNTLGSNCTDINECESPQACLYGNCTNTLGSFSCTCPPNYQLTPAGNACVVLEDINECEEHDNICENGHCTNTFGSFMCSCQ*****
*DTAWLPTFINVTTLTNVTSTNEYVTGDNVITRWVTLTLDGRVETQNPLRSIPIDVTFHVDFPEQDTAWLPTFTNVTTLTNVTSTNEYVTGDNVITRWCVCDEGFRGDGYSCEDIDECTDNTNYCDYILLCGSKPGEFMNPMTNKTEEIDECNLMPNMCNHGTCMNTPGSFHCQCNRGFLYDSDTHQCIDINECEEMPEICGSGTYINECEEMPEICGSGTCENNIGSFSCRYINECEEMPEICGSGTCENNIGSFSCRCEDGYSVKPAEGPACTDENECTMRTHNCDDNADCINNPVNKTGTRCVDIDECATSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECIDMRRELCYLNYTDGLCSLPMSNEQTRMVCCCSMGQSWGKPCQPCPPPGSRDYILLCGKDFAKLCPEGVGRGDKGEDLNECRTVITVRDSYFTEQWRDAKKNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQTCEDINECLELSNQCAFRCHNISMSVSNSLACALTPVLTRKISMSVSNSLACALTPVLTRKVATPVAVINDCIDLDECRMMSYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDECKEVNKRESRCYLDTEEEEEEEEEEEGGYGGGSRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEHKTLCPGGSGYRPNSATREGICPSPGKCQNVMGSFICTCPPGYRLSPDKNSCQEDFAKLCPEGVGRGDKGEDLNECALMPSACQGGECINTDGSYRCECPAGYVKDETGKICIDDNECLSIPNICGNGTCTNLNGGFECTCSEGYAPGPLGSCAILLTLPPISPSTDIDECYERPGICANGDCANFQGSFQCTCANGYTLNTARDSCVDIDECARHPNICNNGTCVNAIGSFKCHCYAGFKLSHNNDCIGNCTDINECESPQACLYGNCTNTLGSNCTDINECESPQACLYGNCTNTLGSFSCTCPPNYQLTPAGNACVVLEDINECEEHDNICENGHCTNTFGSFMCSCQDGFKL
QDTAWLPTFINVTTLTNVTSTNEYVTGDNVITRWVTLTLDGRVETQNPLRSIPIDVTFHVDFPEQDTAWLPTFTNVTTLTNVTSTNEYVTGDNVITRWCVCDEGFRGDGYSCEDIDECTDNTNYCDYILLCGSKPGEFMNPMTNKTEEIDECNLMPNMCNHGTCMNTPGSFHCQCNRGFLYDSDTHQCIDINECEEMPEICGSGTYINECEEMPEICGSGTCENNIGSFSCRYINECEEMPEICGSGTCENNIGSFSCRCEDGYSVKPAEGPACTDENECTMRTHNCDDNADCINNPVNKTGTRCVDIDECATSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECIDMRRELCYLNYTDGLCSLPMSNEQTRMVCCCSMGQSWGKPCQPCPPPGSRDYILLCGKDFAKLCPEGVGRGDKGEDLNECRTVITVRDSYFTEQWRDAKKNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQTCEDINECLELSNQCAFRCHNISMSVSNSLACALTPVLTRKISMSVSNSLACALTPVLTRKVATPVAVINDCIDLDECRMMSYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDECKEVNKRESR**********************SRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEHKTLCPGGSGYRPNSATREGICPSPGKCQNVMGSFICTCPPGYRLSPDKNSCQEDFAKLCPEGVGRGDKGEDLNECALMPSACQGGECINTDGSYRCECPAGYVKDETGKICIDDNECLSIPNICGNGTCTNLNGGFECTCSEGYAPGPLGSCAILLTLPPISPSTDIDECYERPGICANGDCANFQGSFQCTCANGYTLNTARDSCVDIDECARHPNICNNGTCVNAIGSFKCHCYAGFKLSHNNDCIGNCTDINECESPQACLYGNCTNTLGSNCTDINECESPQACLYGNCTNTLGSFSCTCPPNYQLTPAGNACVVLEDINECEEHDNICENGHCTNTFGSFMCSCQDGFKL
*DTAWLPTFINVTTLTNVTSTNEYVTGDNVITRWVTLTLDGRVETQNPLRSIPIDVTFHVDFPEQDTAWLPTFTNVTTLTNVTSTNEYVTGDNVITRWCVCDEGFRGDGYSCEDIDECTDNTNYCDYILLCGSKPGEFMNPMTNKTEEIDECNLMPNMCNHGTCMNTPGSFHCQCNRGFLYDSDTHQCIDINECEEMPEICGSGTYINECEEMPEICGSGTCENNIGSFSCRYINECEEMPEICGSGTCENNIGSFSCRCEDGYSVKPAEGPACTDENECTMRTHNCDDNADCINNPVNKTGTRCVDIDECATSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECIDMRRELCYLNYTDGLCSLPMSNEQTRMVCCCSMGQSWGKPCQPCPPPGSRDYILLCGKDFAKLCPEGVGRGDKGEDLNECRTVITVRDSYFTEQWRDAKKNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQTCEDINECLELSNQCAFRCHNISMSVSNSLACALTPVLTRKISMSVSNSLACALTPVLTRKVATPVAVINDCIDLDECRMMSYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDECKEVNKRESRCYLDTEEEEEEEEEEEGGYGGGSRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEHKTLCPGGSGYRPNSATREGICPSPGKCQNVMGSFICTCPPGYRLSPDKNSCQEDFAKLCPEGVGRGDKGEDLNECALMPSACQGGECINTDGSYRCECPAGYVKDETGKICIDDNECLSIPNICGNGTCTNLNGGFECTCSEGYAPGPLGSCAILLTLPPISPSTDIDECYERPGICANGDCANFQGSFQCTCANGYTLNTARDSCVDIDECARHPNICNNGTCVNAIGSFKCHCYAGFKLSHNNDCIGNCTDINECESPQACLYGNCTNTLGSNCTDINECESPQACLYGNCTNTLGSFSCTCPPNYQLTPAGNACVVLEDINECEEHDNICENGHCTNTFGSFMCSCQDGF*L
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QDTAWLPTFINVTTLTNVTSTNEYVTGDNVITRWVTLTLDGRVETQNPLRSIPIDVTFHVDFPEQDTAWLPTFTNVTTLTNVTSTNEYVTGDNVITRWCVCDEGFRGDGYSCEDIDECTDNTNYCDYILLCGSKPGEFMNPMTNKTEEIDECNLMPNMCNHGTCMNTPGSFHCQCNRGFLYDSDTHQCIDINECEEMPEICGSGTYINECEEMPEICGSGTCENNIGSFSCRYINECEEMPEICGSGTCENNIGSFSCRCEDGYSVKPAEGPACTDENECTMRTHNCDDNADCINNPVNKTGTRCVDIDECATSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECIDMRRELCYLNYTDGLCSLPMSNEQTRMVCCCSMGQSWGKPCQPCPPPGSRDYILLCGKDFAKLCPEGVGRGDKGEDLNECRTVITVRDSYFTEQWRDAKKNQRLGFCYRSLTNGRCVLPTGPALLMEVTRMDCCCTMGMAWGPQCQLCPTRGSQTCEDINECLELSNQCAFRCHNISMSVSNSLACALTPVLTRKISMSVSNSLACALTPVLTRKVATPVAVINDCIDLDECRMMSYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDECKEVNxxxxxxxxxxxxxxxxxxxxxGGYGGGSRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEHKTLCPGGSGYRPNSATREGICPSPGKCQNVMGSFICTCPPGYRLSPDKNSCQEDFAKLCPEGVGRGDKGEDLNECALMPSACQGGECINTDGSYRCECPAGYVKDETGKICIDDNECLSIPNICGNGTCTNLNGGFECTCSEGYAPGPLGSCAILLTLPPISPSTDIDECYERPGICANGDCANFQGSFQCTCANGYTLNTARDSCVDIDECARHPNICNNGTCVNAIGSFKCHCYAGFKLSHNNDCIGNCTDINECESPQACLYGNCTNTLGSNCTDINECESPQACLYGNCTNTLGSFSCTCPPNYQLTPAGNACVVLEDINECEEHDNICENGHCTNTFGSFMCSCQDGFKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1050 2.2.26 [Sep-21-2011]
P98133 2871 Fibrillin-1 OS=Bos taurus yes N/A 0.806 0.295 0.313 1e-103
P35555 2871 Fibrillin-1 OS=Homo sapie yes N/A 0.813 0.297 0.313 1e-102
Q61554 2871 Fibrillin-1 OS=Mus muscul yes N/A 0.787 0.288 0.316 1e-101
Q61555 2907 Fibrillin-2 OS=Mus muscul no N/A 0.751 0.271 0.302 1e-100
P35556 2912 Fibrillin-2 OS=Homo sapie no N/A 0.750 0.270 0.303 8e-99
Q9TV36 2871 Fibrillin-1 OS=Sus scrofa yes N/A 0.754 0.275 0.323 3e-96
Q75N90 2809 Fibrillin-3 OS=Homo sapie no N/A 0.755 0.282 0.315 8e-96
Q8N2S1 1624 Latent-transforming growt no N/A 0.569 0.368 0.313 2e-65
Q8CG19 1712 Latent-transforming growt no N/A 0.614 0.376 0.295 3e-64
Q00918 1712 Latent-transforming growt no N/A 0.614 0.376 0.295 5e-64
>sp|P98133|FBN1_BOVIN Fibrillin-1 OS=Bos taurus GN=FBN1 PE=1 SV=1 Back     alignment and function desciption
 Score =  376 bits (966), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 331/1055 (31%), Positives = 460/1055 (43%), Gaps = 208/1055 (19%)

Query: 141  PMTNKTEEIDECNLMPNMCNHGTCMNTPGSFHCQCNRGFLYDSDTHQCIDINECEEMPEI 200
            P        D C L   +C +G C+ TPGS+ C+CN+GF  D    +CID++ECE+ P  
Sbjct: 442  PRVLPVNVTDYCQLFRYLCQNGRCIPTPGSYRCECNKGFQLDL-RGECIDVDECEKNP-- 498

Query: 201  CGSGTYINECEEMPEICGSGTCENNIGSFSCRYINECEEMPEICGSGTCENNIGSFSCRC 260
            C  G  IN        C  G  ++ +    CR I+EC +   IC +G C N  GSF C C
Sbjct: 499  CAGGECINTQGSYTCQCRPGY-QSTLTRTECRDIDECLQNGRICNNGRCINTDGSFHCVC 557

Query: 261  EDGYSVKPAEGPACTDENECTMRTH-------NCDDNADCINNP---VNKTGTRCVDIDE 310
              G+ V   +G  C D +EC++R         N D +  CI  P   +   G  C DI+E
Sbjct: 558  NAGFHVT-RDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKPGFQLASDGRYCKDINE 616

Query: 311  CATSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECIDMR-RELCYLNYTDGLCSLPMS 369
            C T +  C  G CVN  G+Y C C  G  +   G+ C+D   R  CY  Y  G C  P+ 
Sbjct: 617  CET-LGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRSTCYGGYKRGQCVKPLF 675

Query: 370  NEQTRMVCCCSMGQ-SWGKPCQPCPPPGSRDYILLCGKDFAKLCPEGVGRGDKGEDLNEC 428
               T+  CCC+  + ++G+PCQPCP   S +Y          LC  G G    G D+NEC
Sbjct: 676  GAVTKSECCCASTEYAFGEPCQPCPSQNSAEY--------QALCSSGPGITSAGSDINEC 727

Query: 429  RTVITVRDSYFTEQWRDAKK---NQRLGFCYRSLTNGRCVLPTGPALLMEVT-------- 477
                 +  +   E  R   K   N      Y   + G+  +     +L  +         
Sbjct: 728  ALDPDICPNGICENLRGTYKCICNSG----YEVDSTGKNCVDINECVLNSLLCDNGQCRN 783

Query: 478  ---RMDCCCTMGMAWGPQCQLCPTRGSQTCEDINECLE---LSNQC-----AFRCHNISM 526
                  C C  G  + P+         +TCEDI+EC     ++  C     +F C   S 
Sbjct: 784  TPGSFVCTCPKGFIYKPE--------LKTCEDIDECESSPCINGVCKNSPGSFICECSSE 835

Query: 527  SVSNSL----------ACALTPVLTR---KISMSVSNSLACALTPVLTRKVATPVAVI-- 571
            S  +             C  T +  R    I+ +   S  C+          TP  V   
Sbjct: 836  STLDPTKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTPCQVDPI 895

Query: 572  ----------NDCIDLDECRMMSYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDE 621
                        C D+DEC +   +C+NG C N+ GSF C+C  G TL + G+ C D+  
Sbjct: 896  CGKGYSRIKGTQCEDIDECEVFPGVCKNGLCVNSKGSFKCQCPSGMTLDATGRICLDI-- 953

Query: 622  CKEVNKRESRCYLDTEEEEEEEEEEEGGYGGGSRRVTCTKEIAGSTTRSTCCCSIGKAWG 681
                  R   C+L  E+EE                  CT  +AG      CCCS+G AWG
Sbjct: 954  ------RLETCFLRYEDEE------------------CTLPVAGRHRMDACCCSVGAAWG 989

Query: 682  -PQCEECPAVGSDEHKTLCPGGSGYRPNSATR--------------EGICPSPGKCQNVM 726
              +CEECP   + E++ LCP G G+     T                 +C + GKC+N +
Sbjct: 990  TEECEECPVRNTPEYEELCPRGPGFATKEITNGKRFFKDINECKMIPNLC-THGKCRNTI 1048

Query: 727  GSFICTCPPGYRLSPDKNSCQE-DFAKLCPEGVGRG-------------DKGE------- 765
            GSF C C  G+ L  ++ +C + D  ++ P+  GRG             D+G        
Sbjct: 1049 GSFKCRCDSGFALDSEERNCTDIDECRISPDLCGRGQCVNTPGDFECKCDEGYESGFMMM 1108

Query: 766  ----DLNECALMPSACQGGECINTDGSYRCECPAGYVKDETGKICIDDNECLSIPNICGN 821
                D++EC   P  C+GG C+NT+GSYRCECP G+        CID NEC    ++C +
Sbjct: 1109 KNCMDIDECQRDPLLCRGGVCLNTEGSYRCECPPGHQLAPNISACIDINECELSAHLCPH 1168

Query: 822  GTCTNLNGGFECTCSEGYAPGP-------LGSCAIL-----------------------L 851
            G C NL G ++C C+ GY   P       +  C+I+                        
Sbjct: 1169 GRCVNLIGKYQCACNPGYHSTPDRLFCVDIDECSIMNGGCETFCTNSEGSYECSCQPGFA 1228

Query: 852  TLPPISPSTDIDECYERPGICANGDCANFQGSFQCTCANGYTLNTARDSCVDIDECARHP 911
             +P     TDIDEC + P IC  G C N  G ++C C +G+  +    +CVD++EC  +P
Sbjct: 1229 LMPDQRSCTDIDECEDNPNICDGGQCTNIPGEYRCLCYDGFMASEDMKTCVDVNECDLNP 1288

Query: 912  NICNNGTCVNAIGSFKCHCYAGFKLSHNNDCIGNCTDINECE-SPQAC-LYGNCTNTLGS 969
            NIC +GTC N  GSF CHC  G+           CTDINECE     C  +  CTNT GS
Sbjct: 1289 NICLSGTCENTKGSFICHCDMGYSGKKGKT---GCTDINECEIGAHNCDRHAVCTNTAGS 1345

Query: 970  --------------NCTDINECE--SPQACLYGNCTNTLGSFSCTCPPNYQLTPAGNACV 1013
                           CTD++EC   +     + +C NT+GS+ C C   Y  T  G  C 
Sbjct: 1346 FKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCLCKEGY--TGDGFTCT 1403

Query: 1014 VLEDINECEEHDNICENGHCTNTFGSFMCSCQDGF 1048
               D++EC E+ N+C NG C N  G + C C  GF
Sbjct: 1404 ---DLDECSENLNLCGNGQCLNAPGGYRCECDMGF 1435
Fibrillins are structural components of 10-12 nm extracellular calcium-binding microfibrils, which occur either in association with elastin or in elastin-free bundles. Fibrillin-1-containing microfibrils provide long-term force bearing structural support. Regulates osteoblast maturation by controlling TGF-beta bioavailability and calibrating TGF-beta and BMP levels, respectively.
Bos taurus (taxid: 9913)
>sp|P35555|FBN1_HUMAN Fibrillin-1 OS=Homo sapiens GN=FBN1 PE=1 SV=3 Back     alignment and function description
>sp|Q61554|FBN1_MOUSE Fibrillin-1 OS=Mus musculus GN=Fbn1 PE=1 SV=1 Back     alignment and function description
>sp|Q61555|FBN2_MOUSE Fibrillin-2 OS=Mus musculus GN=Fbn2 PE=1 SV=2 Back     alignment and function description
>sp|P35556|FBN2_HUMAN Fibrillin-2 OS=Homo sapiens GN=FBN2 PE=1 SV=3 Back     alignment and function description
>sp|Q9TV36|FBN1_PIG Fibrillin-1 OS=Sus scrofa GN=FBN1 PE=2 SV=1 Back     alignment and function description
>sp|Q75N90|FBN3_HUMAN Fibrillin-3 OS=Homo sapiens GN=FBN3 PE=2 SV=3 Back     alignment and function description
>sp|Q8N2S1|LTBP4_HUMAN Latent-transforming growth factor beta-binding protein 4 OS=Homo sapiens GN=LTBP4 PE=1 SV=2 Back     alignment and function description
>sp|Q8CG19|LTBP1_MOUSE Latent-transforming growth factor beta-binding protein 1 OS=Mus musculus GN=Ltbp1 PE=2 SV=2 Back     alignment and function description
>sp|Q00918|LTBP1_RAT Latent-transforming growth factor beta-binding protein 1 OS=Rattus norvegicus GN=Ltbp1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1050
328715164 3100 PREDICTED: fibrillin-2-like [Acyrthosiph 0.801 0.271 0.324 1e-126
332018680 2757 Fibrillin-2 [Acromyrmex echinatior] 0.853 0.324 0.332 1e-118
321472519 2762 hypothetical protein DAPPUDRAFT_315775 [ 0.721 0.274 0.313 1e-118
350416792 2865 PREDICTED: fibrillin-2-like [Bombus impa 0.777 0.284 0.339 1e-117
340721645 2865 PREDICTED: fibrillin-2-like [Bombus terr 0.777 0.284 0.340 1e-117
307196014 2862 Fibrillin-2 [Harpegnathos saltator] 0.789 0.289 0.334 1e-116
383864528 2865 PREDICTED: fibrillin-2-like [Megachile r 0.785 0.287 0.338 1e-116
380016550 2868 PREDICTED: fibrillin-2-like [Apis florea 0.766 0.280 0.333 1e-115
242016322 2816 Fibrillin-2 precursor, putative [Pedicul 0.851 0.317 0.324 1e-114
328787226 2870 PREDICTED: fibrillin-2-like [Apis mellif 0.766 0.280 0.333 1e-114
>gi|328715164|ref|XP_001945971.2| PREDICTED: fibrillin-2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  459 bits (1181), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 390/1203 (32%), Positives = 515/1203 (42%), Gaps = 361/1203 (30%)

Query: 99   CVCDEGFRGDGYSCEDIDECTDNTNYCDYILLCGSKPGEF--------MNPMTNKTE--- 147
            CVCD+GFRGDGYSC DIDECT+++  C+    C + PG F        +NP  +K E   
Sbjct: 1546 CVCDDGFRGDGYSCIDIDECTEDSTLCEN-GHCLNYPGSFRCECEMGFINP-DDKNERSC 1603

Query: 148  -EIDECNLM-----------------------------------------PNMCNHGTCM 165
             +I+EC++                                          P  C +G C+
Sbjct: 1604 NDINECHMFNNLCVYGNCENIFGTFRCECSGGYQLDNTGGNCTDVNECESPQACLYGECI 1663

Query: 166  NTPGSFHCQCNRGFLYDSDTHQCIDINECEEMPEICGSG--------------------- 204
            N  G++ C+C   +      + C+D  E     E+   G                     
Sbjct: 1664 NNEGNYTCKCPPNYQLVPAGNACVDKREGRCYMEVEDRGGQRLCHHEMGSAVSKATCCCS 1723

Query: 205  ---TYINECEEMPEI--------CGSGT-CENNIGSFSCRYINECEEMPEICGSGTCENN 252
                + + CE  PE+        C  GT    N  +     +NECEE   +C +G C N 
Sbjct: 1724 VGKAWGSRCESCPEVETEEYKTLCPGGTGYRPNPTTVILEDVNECEEHDNLCTNGHCTNT 1783

Query: 253  IGSFSCRCEDGYSVKPAEGPACTDENECTMRTHNCDDNADCINNPVNKTGTRCVDIDECA 312
             GS+ C C +GY +                                + T T C D+DEC 
Sbjct: 1784 FGSYMCSCNEGYRL--------------------------------DNTSTFCYDVDECN 1811

Query: 313  TSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECIDMRRELCYLNYTDGLCSLPMSNEQ 372
             + + CG GFC N+VGTYHCVCPDGYMLLP+GKEC+DMR++ C+LNYT+G CS+PMSN Q
Sbjct: 1812 ENPEICGVGFCSNEVGTYHCVCPDGYMLLPNGKECVDMRKDNCFLNYTNGQCSVPMSNSQ 1871

Query: 373  TRMVCCCSMGQSWGKPCQPCPPPGSRDYILLCGKDFAKLCPEGVGRGDKGEDLNECRTV- 431
            TRM+CCCSMGQ+WG PCQPCP   +++Y+LLCG     +      R    E+++EC  + 
Sbjct: 1872 TRMICCCSMGQAWGLPCQPCPASSTKEYLLLCGSRPGLIMNPMTNR---TEEIDECTLMP 1928

Query: 432  --------ITVRDSYFTE----QWRDAKKNQRLGFCYRSLTNGRCVLPTGPALLMEV--- 476
                    +    S+          DA  +Q        + +  C+    P   +     
Sbjct: 1929 NMCNHGSCVNTPGSFHCSCDGGYVYDANSHQ-------CIDDNECLRIPAPCRGISQCVN 1981

Query: 477  --TRMDCCCTMGMAWGPQCQLCPTRGSQTCEDINECLELSNQC----------AFR--CH 522
                 +C C  G   G          ++ C D++EC E    C          +F+  CH
Sbjct: 1982 TPGSFECQCPEGYKLGST--------ARECVDVDECYERDGICRDGECANLDGSFQCTCH 2033

Query: 523  NISMSVSNSLACALTPVLTRKISMSVSNSLACALTPVLTRKVA----TPVAVINDCIDLD 578
            N     +    C      +R    +V N+  C L  V + K +      ++  NDCID+D
Sbjct: 2034 NGYTLTAARDTCVDVDECSRH--QNVCNNGTC-LNTVGSFKCSCFDGFKLSHNNDCIDVD 2090

Query: 579  ECRMMSYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDECKEVNKRESRCYLDTEE 638
            ECRMM +LCRNGRC+N +G F CEC+ GY L+++GQ+CRD+DEC E+         DT  
Sbjct: 2091 ECRMMPFLCRNGRCKNTMGGFSCECISGYILSTDGQHCRDIDECTEI--------PDTCP 2142

Query: 639  EEEEEEEEEGGYGGGSRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEHKTL 698
            +    +   G +       TC      S  +++C          +C+E P +        
Sbjct: 2143 QPGRCQNLMGSF-----LCTCPPGYRLSAAKNSC------LDINECQEMPGI-------- 2183

Query: 699  CPGGSGYRPNSATREGICPSPGKCQNVMGSFICTCPPGYRLSPDKNSC------------ 746
            C GG+                  C N  G  IC CP G+ LS +   C            
Sbjct: 2184 CDGGT------------------CMNTDGGVICDCPEGFVLSSNGMKCIDTRQDHCFDKY 2225

Query: 747  -------------------------------------QEDFAKLCPEGVGRGDKGEDLNE 769
                                                  + FAKLCPEGVGRGDKGEDLNE
Sbjct: 2226 LSGNCLAPRKQRITEKECCCSAGGGWGRLCTACPKPGSDAFAKLCPEGVGRGDKGEDLNE 2285

Query: 770  CALMPSACQGGECINTDGSYRCECPAGYVKDETGKICIDDNECLSIPNICGNGTCTNLNG 829
            C  M + C GGECINTDGSYRCECP GYV D TGK C+D+NEC    NICGNGTCTNL G
Sbjct: 2286 CDFMTNPCDGGECINTDGSYRCECPTGYVLDSTGKKCMDENECKINVNICGNGTCTNLQG 2345

Query: 830  GFECTCSEGYAPGPLGSCAIL-----------------------------LTLPPISPST 860
            GFEC C++G+APGP   C  +                                P      
Sbjct: 2346 GFECICADGFAPGPTQVCEDVNECMEMSNQCAFRCHNVPGSFRCICPYGYALAPDGRHCQ 2405

Query: 861  DIDECYERPGICANGDCANFQGSFQCTCANGYTLNTARDSCVDIDECARHPNICNNGTCV 920
            D+DEC      C    C N  GSF C C  GY      D C DI+ECA + N+C NG CV
Sbjct: 2406 DVDECLTPANNCKFA-CKNLIGSFACICPEGYA-QVGSDECRDINECAENANVCQNGYCV 2463

Query: 921  NAIGSFKCHCYAGFKLSH------------------NNDCI-----GNCTDI-------- 949
            N  GS+KC CY GFK S+                  NN CI     GN T          
Sbjct: 2464 NQPGSYKCDCYDGFKTSYDGKQCIDSRVGFCYRHLLNNRCINHVGGGNVTGAVAYRSVTK 2523

Query: 950  ---------------NECESP------QACLYGNCTNTLGSNCTDINECES-PQACLYGN 987
                             C SP      Q CL    T     +  DINECE+ P  C  G 
Sbjct: 2524 ADCCCSMAAAWGPQCQPCPSPSSDSFRQLCLESGYT----IDGQDINECETLPDLCTNGR 2579

Query: 988  CTNTLGSFSCTCPPNYQLTPAGNACVVLEDINECEEHDNICENGHCTNTFGSFMCSCQDG 1047
            C NTLGS+ C+C   +++   G  C    D+NEC  + + CE   C N  G + C C  G
Sbjct: 2580 CINTLGSYRCSCNKAFKVDHTGTHC---NDVNECLLNPSPCEM-SCQNLEGGYACGCPAG 2635

Query: 1048 FKL 1050
            + L
Sbjct: 2636 YLL 2638

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332018680|gb|EGI59252.1| Fibrillin-2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|321472519|gb|EFX83489.1| hypothetical protein DAPPUDRAFT_315775 [Daphnia pulex] Back     alignment and taxonomy information
>gi|350416792|ref|XP_003491105.1| PREDICTED: fibrillin-2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340721645|ref|XP_003399227.1| PREDICTED: fibrillin-2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307196014|gb|EFN77739.1| Fibrillin-2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383864528|ref|XP_003707730.1| PREDICTED: fibrillin-2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380016550|ref|XP_003692245.1| PREDICTED: fibrillin-2-like [Apis florea] Back     alignment and taxonomy information
>gi|242016322|ref|XP_002428778.1| Fibrillin-2 precursor, putative [Pediculus humanus corporis] gi|212513463|gb|EEB16040.1| Fibrillin-2 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328787226|ref|XP_003250904.1| PREDICTED: fibrillin-2-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1050
UNIPROTKB|P98133 2871 FBN1 "Fibrillin-1" [Bos taurus 0.753 0.275 0.326 4.4e-117
UNIPROTKB|F1N4K8 2871 FBN1 "Fibrillin-1" [Bos taurus 0.753 0.275 0.326 9.2e-117
UNIPROTKB|G3V9M6 2872 Fbn1 "Fibrillin 1, isoform CRA 0.772 0.282 0.320 3.1e-116
UNIPROTKB|F1NII7 2822 FBN1 "Uncharacterized protein" 0.794 0.295 0.318 3.5e-116
UNIPROTKB|F1NJQ9 2838 FBN1 "Uncharacterized protein" 0.794 0.293 0.318 3.5e-116
UNIPROTKB|P35555 2871 FBN1 "Fibrillin-1" [Homo sapie 0.755 0.276 0.324 2.8e-115
ZFIN|ZDB-GENE-090112-3 2868 fbn2b "fibrillin 2b" [Danio re 0.767 0.281 0.305 7.4e-116
UNIPROTKB|F1PIA3 2871 FBN1 "Uncharacterized protein" 0.753 0.275 0.324 1.1e-115
UNIPROTKB|Q75N90 2809 FBN3 "Fibrillin-3" [Homo sapie 0.807 0.301 0.294 5.7e-107
MGI|MGI:95489 2871 Fbn1 "fibrillin 1" [Mus muscul 0.753 0.275 0.323 1.2e-110
UNIPROTKB|P98133 FBN1 "Fibrillin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 1133 (403.9 bits), Expect = 4.4e-117, Sum P(2) = 4.4e-117
 Identities = 312/957 (32%), Positives = 423/957 (44%)

Query:    99 CVCDEGF-RGDGYS-CEDIDECTDNTNYCDYILLC----GS-----KPGEFMNPMTNKTE 147
             C C  GF   D    CEDIDEC  N   C     C    GS     KPG +    T +  
Sbjct:  1791 CECPVGFFYNDKLLVCEDIDEC-QNGPVCQRNAECINTAGSYRCDCKPG-YRFTSTGQCN 1848

Query:   148 EIDECNLMPNMCNHGTCMNTPGSFHCQCNRGFLYDSDTHQCIDINECEEMPEICGSGTYI 207
             + +EC  +PN+C+HG C++T GSF+C C+ GF  ++D   C+DINECE   + CG+GT  
Sbjct:  1849 DRNECQEIPNICSHGQCIDTVGSFYCLCHTGFKTNADQTMCLDINECER--DACGNGT-- 1904

Query:   208 NECEEMPEICGSGTCENNIGSFSCRYINECEEMPE-------ICGSGTCENNIGSFSCRC 260
               C       GS  C  N G F   + N+C ++ E       +C +G C N +GSF C+C
Sbjct:  1905 --CRNT---IGSFNCRCNHG-FILSHNNDCIDVDECATGNGNLCRNGQCINTVGSFQCQC 1958

Query:   261 EDGYSVKPAEGPACTDENECTMRTHNCD----DNAD----CINNP-VNKTGTRCVDIDEC 311
              +GY V P +G  C D NEC +    C      N D    CI  P  +    +C DIDEC
Sbjct:  1959 NEGYEVAP-DGRTCVDINECLLDPRKCAPGTCQNLDGSYRCICPPGYSLQNDKCEDIDEC 2017

Query:   312 ATSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECIDMRRELCYLNYTDGLCSLPMSNE 371
                 + C  G C N  G++ C+CPDG+ L  +G+ C D+R   CY  +  G CS P S  
Sbjct:  2018 VEEPEICALGTCSNTEGSFKCLCPDGFSLSSTGRRCQDLRMSYCYAKFEGGKCSSPKSRN 2077

Query:   372 QTRMVCCCSM-GQSWGKPCQPCPPPGSRDYILLCGKDFAKLCPEG----VGRGDKGEDLN 426
              ++  CCC++ G+ WG PC+ CP            + F ++CP G    VG  D   D++
Sbjct:  2078 HSKQECCCALKGEGWGDPCELCPTEPD--------EAFRQICPYGSGIIVGPDDSAVDMD 2129

Query:   427 ECRTVITVRDSYFTEQWRDAKKNQRLGFCYRS---LTNGRCVL--PTGPALLMEVTR-MD 480
             EC+     +           +     G+  +    +    C +  P G      V    +
Sbjct:  2130 ECKEPDVCKHGQCINTDGSYRCECPFGYILQGNECVDTDECSVGNPCGNGTCKNVIGGFE 2189

Query:   481 CCCTMGMAWGPQCQLCPTRGSQTCEDINECLELSNQCAFRCHNISMSVSNSLACALTPVL 540
             C C  G   GP           TCEDINEC +    CAFRC N   S      C    VL
Sbjct:  2190 CTCEEGFEPGPM---------MTCEDINECAQNPLLCAFRCVNTYGSYE--CKCPAGYVL 2238

Query:   541 TRKISMSVSNSLA------CALTPVLTRK-VATPVAVIND----------CIDLDECRMM 583
                  M             CA   +  +  + T + +             C+D +EC+  
Sbjct:  2239 REDRRMCKDEDECEEGKHDCAEKQMECKNLIGTYLCICGPGYQRRPDGEGCVDENECQTK 2298

Query:   584 SYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDECKEVNKRESRCYLDTXXXXXXX 643
               +C NGRC N  GS+ CEC  G+T AS  Q     DEC  ++ RE  C+ +        
Sbjct:  2299 PGICENGRCLNTRGSYTCECNDGFT-ASPNQ-----DEC--LDNREGYCFTEVLQNMCQI 2350

Query:   644 XXXXXXXXXXSRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEHKTLCPGGS 703
                       S R           T+S CCC  G+ WGP CE CP  G+   K LCP G 
Sbjct:  2351 GS--------SNR--------NPVTKSECCCDGGRGWGPHCEICPFQGTVAFKKLCPHGR 2394

Query:   704 GYRPNSATRE------GICPSPGKCQNVMGSFICTCPPGYR------LSPDKNSCQE--- 748
             G+  N A  +       +C + G+C N  GS+ C C  GY          D N C +   
Sbjct:  2395 GFMTNGADIDECKVIHDVCRN-GECVNDRGSYHCICKTGYTPDITGTACVDLNECNQAPK 2453

Query:   749 -----------DFAKLCPEGVGRGDKG---EDLNECALMPSACQGGECINTDGSYRCECP 794
                         +   CP+G    + G   +DL+ECA     CQ   C+NT GS+ C+CP
Sbjct:  2454 PCNFICKNTEGSYQCSCPKGYILQEDGRSCKDLDECATKQHNCQF-LCVNTIGSFTCKCP 2512

Query:   795 AGYVKDETGKICIDDNECLS-IPXXXXXXXXXXXXXXFECTCSEGYAPGPLG-SCAILLT 852
              G+ +  T   CID+NEC S I               F C C  G++  P G SC     
Sbjct:  2513 PGFTQHHTA--CIDNNECTSDINLCGSKGICQNTPGSFTCECQRGFSLDPTGASCE---- 2566

Query:   853 LPPISPSTDIDECYERPGICANGDCANFQGSFQCTCANGYTLNTARDSCVDIDECARHPN 912
                     D+DEC E    C +G C N  G ++C+C  GY  +   + CVD +EC    +
Sbjct:  2567 --------DVDEC-EGNHRCQHG-CQNIIGGYRCSCPQGYLQHYQWNQCVDENECLS-AH 2615

Query:   913 ICNNGTCVNAIGSFKCHCYAGFKLSHNNDCIGNCTDINECESPQA-CLYGNCTNTLG 968
             IC   +C N +GS+KC C AGF+    +   G C DINEC S QA C YG C+NT G
Sbjct:  2616 ICGGASCHNTLGSYKCMCPAGFQYEQFS---GGCQDINECGSAQAPCSYG-CSNTEG 2668
GO:0005578 "proteinaceous extracellular matrix" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005201 "extracellular matrix structural constituent" evidence=IEA
UNIPROTKB|F1N4K8 FBN1 "Fibrillin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9M6 Fbn1 "Fibrillin 1, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NII7 FBN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJQ9 FBN1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P35555 FBN1 "Fibrillin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090112-3 fbn2b "fibrillin 2b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1PIA3 FBN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q75N90 FBN3 "Fibrillin-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:95489 Fbn1 "fibrillin 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1050
pfam0068342 pfam00683, TB, TB domain 1e-08
pfam0068342 pfam00683, TB, TB domain 4e-06
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 8e-05
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 1e-04
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 1e-04
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 1e-04
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 1e-04
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 2e-04
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 2e-04
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 3e-04
pfam0068342 pfam00683, TB, TB domain 4e-04
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 7e-04
pfam1266224 pfam12662, cEGF, Complement Clr-like EGF-like 9e-04
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 0.001
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 0.001
cd0005438 cd00054, EGF_CA, Calcium-binding EGF-like domain, 0.001
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 0.002
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 0.003
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 0.003
smart0017939 smart00179, EGF_CA, Calcium-binding EGF-like domai 0.004
pfam0764542 pfam07645, EGF_CA, Calcium-binding EGF domain 0.004
>gnl|CDD|201391 pfam00683, TB, TB domain Back     alignment and domain information 
 Score = 51.2 bits (123), Expect = 1e-08
 Identities = 19/41 (46%), Positives = 27/41 (65%)

Query: 658 TCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEHKTL 698
            C+  + G+ T+S CCCS+G+AWG  CE CP  G+ E + L
Sbjct: 2   RCSNPLPGNVTKSECCCSLGRAWGTPCEPCPVQGTAEFRQL 42

This domain is also known as the 8 cysteine domain. This family includes the hybrid domains. This cysteine rich repeat is found in TGF binding protein and fibrillin. Length = 42
>gnl|CDD|201391 pfam00683, TB, TB domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|201391 pfam00683, TB, TB domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|221695 pfam12662, cEGF, Complement Clr-like EGF-like Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|238011 cd00054, EGF_CA, Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information
>gnl|CDD|214542 smart00179, EGF_CA, Calcium-binding EGF-like domain Back     alignment and domain information
>gnl|CDD|219496 pfam07645, EGF_CA, Calcium-binding EGF domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1050
KOG1214|consensus 1289 99.8
KOG1214|consensus1289 99.63
KOG1217|consensus487 99.6
KOG4289|consensus 2531 99.54
KOG1217|consensus487 99.53
KOG0994|consensus 1758 99.48
KOG4289|consensus 2531 99.43
KOG0994|consensus 1758 98.98
KOG1219|consensus 4289 98.96
KOG4260|consensus350 98.96
KOG1219|consensus 4289 98.96
KOG4260|consensus350 98.85
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.5
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 98.37
KOG1225|consensus 525 98.15
KOG1225|consensus525 98.08
PF1266224 cEGF: Complement Clr-like EGF-like 97.85
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.68
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 97.58
PF1266224 cEGF: Complement Clr-like EGF-like 97.52
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.52
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 97.5
KOG1836|consensus 1705 97.49
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 97.36
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.27
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 97.21
smart0017939 EGF_CA Calcium-binding EGF-like domain. 97.1
PF0068342 TB: TB domain; InterPro: IPR002212 Transforming gr 97.08
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.96
KOG1226|consensus783 96.66
PF0000832 EGF: EGF-like domain This is a sub-family of the P 96.6
KOG1226|consensus783 96.52
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.4
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 96.36
KOG1836|consensus 1705 96.02
smart0018135 EGF Epidermal growth factor-like domain. 95.32
smart0018135 EGF Epidermal growth factor-like domain. 95.25
cd0005336 EGF Epidermal growth factor domain, found in epide 95.22
cd0005336 EGF Epidermal growth factor domain, found in epide 95.09
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 94.44
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 93.04
PF0068342 TB: TB domain; InterPro: IPR002212 Transforming gr 93.02
smart0005163 DSL delta serrate ligand. 92.37
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 89.51
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 88.92
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 86.87
PF1294637 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 86.42
smart0005163 DSL delta serrate ligand. 82.77
>KOG1214|consensus Back     alignment and domain information 
Probab=99.80  E-value=7.5e-18  Score=192.95  Aligned_cols=253  Identities=24%  Similarity=0.446  Sum_probs=165.1

Q ss_pred             ceeEeeCCCCccCCCCCCCCCCCCCCccccchhcccCCCccC--ccccccccCCCcceeee--ccccCCccccccCC-cc
Q psy18237        478 RMDCCCTMGMAWGPQCQLCPTRGSQTCEDINECLELSNQCAF--RCHNISMSVSNSLACAL--TPVLTRKISMSVSN-SL  552 (1050)
Q Consensus       478 ~~~C~C~~Gy~g~~~~~~c~~~~~~~C~~~~eC~~~~~~C~~--~C~n~~~~~~~~~~C~C--G~~g~~~~C~~~~~-~~  552 (1050)
                      -+.|.+.+-|.--+..+.+-......=....++. ..-.+++  .++.....-...+.|.+  ++.++...|....+ .|
T Consensus       638 yq~C~h~~~~p~~p~tqql~vd~vfalyn~ee~~-lr~a~Sn~igpV~E~S~~~~~npCy~gsh~cdt~a~C~pg~~~~~  716 (1289)
T KOG1214|consen  638 YQVCRHAPRHPSFPTTQQLNVDRVFALYNDEERV-LRFAVSNQIGPVKEDSDPTPVNPCYDGSHMCDTTARCHPGTGVDY  716 (1289)
T ss_pred             eEEeecCCCCCCCCCceEeecccceeccCccccc-hhhhhhhcccceecCCCCcccccceecCcccCCCccccCCCCcce
Confidence            6778888877632332222111101001111222 2223333  44433322224578888  88888888988754 68


Q ss_pred             ccccCCCCcccccccccccCCcccCccccCCCCCCC-CCeeecCCCceEEecCCCeEeCCCCCccccCccccccCCCCCc
Q psy18237        553 ACALTPVLTRKVATPVAVINDCIDLDECRMMSYLCR-NGRCRNNIGSFFCECLQGYTLASEGQYCRDVDECKEVNKRESR  631 (1050)
Q Consensus       553 ~C~C~~G~~G~~C~~~~~~~~C~dideC~~~~~~C~-ng~C~n~~gsy~C~C~~Gy~~~~~G~~C~~~~eC~~~~~~~~~  631 (1050)
                      +|.|..||.|       +++.|.|++||+.....|. |..|+|.+|+|+|+|..||.+..++.+|..+-.=+        
T Consensus       717 tcecs~g~~g-------dgr~c~d~~eca~~~~~CGp~s~Cin~pg~~rceC~~gy~F~dd~~tCV~i~~pa--------  781 (1289)
T KOG1214|consen  717 TCECSSGYQG-------DGRNCVDENECATGFHRCGPNSVCINLPGSYRCECRSGYEFADDRHTCVLITPPA--------  781 (1289)
T ss_pred             EEEEeeccCC-------CCCCCCChhhhccCCCCCCCCceeecCCCceeEEEeecceeccCCcceEEecCCC--------
Confidence            9999999987       4588999999999889997 78999999999999999999999999998542100        


Q ss_pred             cccCcccchhhhhcccCCcCCCCCccccccCCCCCCCcceeecCCCCccCCCCCCCCCCCCCCCccccCCCCCCCCCCCC
Q psy18237        632 CYLDTEEEEEEEEEEEGGYGGGSRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEHKTLCPGGSGYRPNSAT  711 (1050)
Q Consensus       632 C~~~~~~c~~~~c~~~g~~~~~~~~~~C~~~~~~~~~~~~C~C~~G~~~G~~C~~c~~~~~~~~~~~Cp~g~g~~~~~~~  711 (1050)
                                                                      --..|+.                         
T Consensus       782 ------------------------------------------------p~n~Ce~-------------------------  788 (1289)
T KOG1214|consen  782 ------------------------------------------------PANPCED-------------------------  788 (1289)
T ss_pred             ------------------------------------------------CCCcccc-------------------------
Confidence                                                            0001111                         


Q ss_pred             CCCCCCC--CCEEeecC-CCeEEeCCCCcccCCCCCcccccccccCCCCCCCCCCCCCCCccCCCCCCCC-CCeEEeCCC
Q psy18237        712 REGICPS--PGKCQNVM-GSFICTCPPGYRLSPDKNSCQEDFAKLCPEGVGRGDKGEDLNECALMPSACQ-GGECINTDG  787 (1050)
Q Consensus       712 ~~~~C~~--~g~C~~~~-gsy~C~C~~Gy~g~~~~~~C~~~~~c~C~~g~~~~~~~~~ideC~~~~~~C~-~g~C~~~~g  787 (1050)
                      ..+.|.-  ++.|+... ++|.|.|.|||.|+  +..|.                  ++|||.  |..|+ +++|.++++
T Consensus       789 g~h~C~i~g~a~c~~hGgs~y~C~CLPGfsGD--G~~c~------------------dvDeC~--psrChp~A~Cyntpg  846 (1289)
T KOG1214|consen  789 GSHTCAIAGQARCVHHGGSTYSCACLPGFSGD--GHQCT------------------DVDECS--PSRCHPAATCYNTPG  846 (1289)
T ss_pred             CccccCcCCceEEEecCCceEEEeecCCccCC--ccccc------------------cccccC--ccccCCCceEecCCC
Confidence            0123433  34566554 56999999999985  34444                  789998  56687 579999999


Q ss_pred             CeeeeCCCCceeCCCCCccccC----CccCCC---CCCC-CCC-e--EecCCCceEEecCCCCcCCCC
Q psy18237        788 SYRCECPAGYVKDETGKICIDD----NECLSI---PNIC-GNG-T--CTNLNGGFECTCSEGYAPGPL  844 (1050)
Q Consensus       788 sy~C~C~~Gy~~~~~g~~C~~~----~~C~~~---~~~C-~~g-~--C~~~~g~~~C~C~~Gy~g~~~  844 (1050)
                      +|.|+|.+||.||  |..|+..    ..|...   +..| .+. .  |++ +.+|.+.|.++-.|+..
T Consensus       847 sfsC~C~pGy~GD--Gf~CVP~~~~~T~C~~er~hpl~chg~t~~~~~~D-p~~~e~p~~~~ppG~~~  911 (1289)
T KOG1214|consen  847 SFSCRCQPGYYGD--GFQCVPDTSSLTPCEQERFHPLQCHGSTGFCWCVD-PDGHEVPGTQTPPGSTP  911 (1289)
T ss_pred             cceeecccCccCC--CceecCCCccCCccccccccceeeccccceeEeeC-CCcccCCCCCCCCCCCC
Confidence            9999999999998  8888643    344433   3445 222 1  233 45578888777766533

>KOG1214|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF00683 TB: TB domain; InterPro: IPR002212 Transforming growth factor beta (TGF-beta)-binding protein-like (TB) domain comes from human fibrillin-1[] Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>PF00683 TB: TB domain; InterPro: IPR002212 Transforming growth factor beta (TGF-beta)-binding protein-like (TB) domain comes from human fibrillin-1[] Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>PF12946 EGF_MSP1_1: MSP1 EGF domain 1; InterPro: IPR024730 This EGF-like domain is found at the C terminus of the malaria parasite MSP1 protein Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1050
1uzk_A162 Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Hu 8e-21
1uzk_A162 Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Hu 2e-09
1uzj_A162 Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Hu 1e-20
1uzj_A162 Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Hu 2e-08
1uzj_A162 Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Hu 7e-08
1lmj_A86 Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2 5e-12
1lmj_A86 Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2 3e-10
1lmj_A86 Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2 1e-05
1emn_A82 Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epide 7e-11
1emn_A82 Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epide 1e-10
1emn_A82 Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epide 2e-09
1z6c_A87 Solution Structure Of An Egf Pair (Egf34) From Vita 8e-10
2w86_A147 Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2 1e-09
2w86_A147 Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2 2e-09
2w86_A147 Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2 5e-07
2bo2_A143 Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune Syst 2e-06
2bo2_A143 Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune Syst 5e-04
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 2e-06
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 1e-05
2vj3_A135 Human Notch-1 Egfs 11-13 Length = 135 2e-04
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 4e-06
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 2e-05
1toz_A116 Nmr Structure Of The Human Notch-1 Ligand Binding R 2e-04
3v65_B386 Crystal Structure Of Agrin And Lrp4 Complex Length 3e-05
3v65_B 386 Crystal Structure Of Agrin And Lrp4 Complex Length 4e-05
3v65_B 386 Crystal Structure Of Agrin And Lrp4 Complex Length 2e-04
1apj_A74 Nmr Study Of The Transforming Growth Factor Beta Bi 7e-05
2w2m_E107 Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 1e-04
3p5b_L 400 The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE 2e-04
3bps_E83 Pcsk9:egf-a Complex Length = 83 2e-04
1hz8_A82 Solution Structure And Backbone Dynamics Of A Conca 2e-04
1hj7_A80 Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Ep 2e-04
2w2n_E107 Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr 3e-04
3gcw_E83 Pcsk9:egfa(H306y) Length = 83 4e-04
1ksq_A75 Nmr Study Of The Third Tb Domain From Latent Transf 5e-04
>pdb|1UZK|A Chain A, Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Human Fibrillin-1, Ca Bound To Cbegf23 Domain Only Length = 162 Back     alignment and structure 
Iteration: 1

 Score = 99.8 bits (247), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 66/183 (36%), Positives = 86/183 (46%), Gaps = 33/183 (18%)
Query: 576 DLDECRMMSYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDECKEVNKRESRCYLD 635
           D++EC +    C +G C N  GS+ C+C   + L      C        V+ R   CYLD
Sbjct: 2   DVNEC-LDPTTCISGNCVNTPGSYICDCPPDFELNPTRVGC--------VDTRSGNCYLD 52
Query: 636 TXXXXXXXXXXXXXXXXXSRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEH 695
                             +    C+ EI    ++++CCCS+GKAWG  CE CPAV + E+
Sbjct: 53  IRPRGD------------NGDTACSNEIGVGVSKASCCCSLGKAWGTPCEXCPAVNTSEY 100
Query: 696 KTLCPGGSGYRPNSAT-----------REGICPSPGKCQNVMGSFICTCPPGYRLSPDKN 744
           K LCPGG G+RPN  T             G+C   GKC N  GSF C CP GY L+ D  
Sbjct: 101 KILCPGGEGFRPNPITVILEDIDECQELPGLCQG-GKCINTFGSFQCRCPTGYYLNEDTR 159
Query: 745 SCQ 747
            C 
Sbjct: 160 VCD 162
>pdb|1UZK|A Chain A, Integrin Binding Cbegf22-tb4-cbegf33 Fragment Of Human Fibrillin-1, Ca Bound To Cbegf23 Domain Only Length = 162 Back     alignment and structure
>pdb|1UZJ|A Chain A, Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Human Fibrillin-1, Holo Form. Length = 162 Back     alignment and structure
>pdb|1UZJ|A Chain A, Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Human Fibrillin-1, Holo Form. Length = 162 Back     alignment and structure
>pdb|1UZJ|A Chain A, Integrin Binding Cbegf22-Tb4-Cbegf33 Fragment Of Human Fibrillin-1, Holo Form. Length = 162 Back     alignment and structure
>pdb|1LMJ|A Chain A, Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2+ Binding Epidermal Growth Factor-like Domains Length = 86 Back     alignment and structure
>pdb|1LMJ|A Chain A, Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2+ Binding Epidermal Growth Factor-like Domains Length = 86 Back     alignment and structure
>pdb|1LMJ|A Chain A, Nmr Study Of The Fibrillin-1 Cbegf12-13 Pair Of Ca2+ Binding Epidermal Growth Factor-like Domains Length = 86 Back     alignment and structure
>pdb|1EMN|A Chain A, Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epidermal Growth Factor-Like Domains, Minimized Average Structure Length = 82 Back     alignment and structure
>pdb|1EMN|A Chain A, Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epidermal Growth Factor-Like Domains, Minimized Average Structure Length = 82 Back     alignment and structure
>pdb|1EMN|A Chain A, Nmr Study Of A Pair Of Fibrillin Ca2+ Binding Epidermal Growth Factor-Like Domains, Minimized Average Structure Length = 82 Back     alignment and structure
>pdb|1Z6C|A Chain A, Solution Structure Of An Egf Pair (Egf34) From Vitamin K- Dependent Protein S Length = 87 Back     alignment and structure
>pdb|2W86|A Chain A, Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2cbegf10, Calcium Saturated Form Length = 147 Back     alignment and structure
>pdb|2W86|A Chain A, Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2cbegf10, Calcium Saturated Form Length = 147 Back     alignment and structure
>pdb|2W86|A Chain A, Crystal Structure Of Fibrillin-1 Domains Cbegf9hyb2cbegf10, Calcium Saturated Form Length = 147 Back     alignment and structure
>pdb|2BO2|A Chain A, Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune System Molecule, In Complex With Calcium. Length = 143 Back     alignment and structure
>pdb|2BO2|A Chain A, Egf Domains 1,2,5 Of Human Emr2, A 7-Tm Immune System Molecule, In Complex With Calcium. Length = 143 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|2VJ3|A Chain A, Human Notch-1 Egfs 11-13 Length = 135 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|1TOZ|A Chain A, Nmr Structure Of The Human Notch-1 Ligand Binding Region Length = 116 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|3V65|B Chain B, Crystal Structure Of Agrin And Lrp4 Complex Length = 386 Back     alignment and structure
>pdb|1APJ|A Chain A, Nmr Study Of The Transforming Growth Factor Beta Binding Protein-Like Domain (Tb Module8-Cys Domain), Nmr, 21 Structures Length = 74 Back     alignment and structure
>pdb|2W2M|E Chain E, Wt Pcsk9-Deltac Bound To Wt Egf-A Of Ldlr Length = 107 Back     alignment and structure
>pdb|3P5B|L Chain L, The Structure Of The LdlrPCSK9 COMPLEX REVEALS THE RECEPTOR IN AN Extended Conformation Length = 400 Back     alignment and structure
>pdb|3BPS|E Chain E, Pcsk9:egf-a Complex Length = 83 Back     alignment and structure
>pdb|1HZ8|A Chain A, Solution Structure And Backbone Dynamics Of A Concatemer Of Egf-Homology Modules Of The Human Low Density Lipoprotein Receptor Length = 82 Back     alignment and structure
>pdb|1HJ7|A Chain A, Nmr Study Of A Pair Of Ldl Receptor Ca2+ Binding Epidermal Growth Factor-Like Domains, 20 Structures Length = 80 Back     alignment and structure
>pdb|2W2N|E Chain E, Wt Pcsk9-Deltac Bound To Egf-A H306y Mutant Of Ldlr Length = 107 Back     alignment and structure
>pdb|3GCW|E Chain E, Pcsk9:egfa(H306y) Length = 83 Back     alignment and structure
>pdb|1KSQ|A Chain A, Nmr Study Of The Third Tb Domain From Latent Transforming Growth Factor-Beta Binding Protein-1 Length = 75 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1050
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-35
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 4e-34
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-28
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 3e-24
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 6e-23
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 4e-21
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-13
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 3e-13
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 3e-11
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 4e-08
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 1e-05
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 2e-04
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-26
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 2e-26
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 1e-22
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 8e-19
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 1e-10
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 9e-10
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 7e-06
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 1e-22
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 9e-20
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 1e-19
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-18
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 5e-17
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 4e-15
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-14
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 1e-11
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 1e-08
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 2e-07
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 5e-21
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 3e-17
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 1e-16
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 8e-14
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 7e-11
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 5e-09
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 2e-04
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 2e-20
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 7e-17
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 1e-15
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 1e-15
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 5e-15
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 1e-13
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 1e-12
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 6e-12
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 3e-10
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 5e-09
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 5e-08
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 2e-07
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 3e-20
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 5e-19
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 6e-19
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 7e-18
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 8e-14
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 1e-12
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 1e-11
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 1e-09
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 1e-07
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 1e-07
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 2e-04
2bou_A143 EGF-like module containing mucin-like hormone rece 1e-19
2bou_A143 EGF-like module containing mucin-like hormone rece 1e-19
2bou_A143 EGF-like module containing mucin-like hormone rece 5e-17
2bou_A143 EGF-like module containing mucin-like hormone rece 6e-16
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-15
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-14
2bou_A143 EGF-like module containing mucin-like hormone rece 6e-13
2bou_A143 EGF-like module containing mucin-like hormone rece 1e-06
2bou_A143 EGF-like module containing mucin-like hormone rece 2e-06
2bou_A143 EGF-like module containing mucin-like hormone rece 8e-06
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 1e-18
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 4e-18
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 1e-14
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 1e-14
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 1e-12
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 1e-09
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 2e-09
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 9e-06
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 1e-15
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 3e-15
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 7e-13
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 1e-12
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 2e-12
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 1e-11
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 1e-10
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 6e-04
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 2e-15
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 2e-15
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 1e-10
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 1e-09
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 2e-07
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 3e-06
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 5e-06
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 1e-05
1apj_A74 Fibrillin; microfibril, TB module, marfan syndrome 3e-15
1apj_A74 Fibrillin; microfibril, TB module, marfan syndrome 9e-12
1apj_A74 Fibrillin; microfibril, TB module, marfan syndrome 5e-08
1ksq_A75 Latent transforming growth factor beta binding pro 4e-14
1ksq_A75 Latent transforming growth factor beta binding pro 1e-08
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 4e-14
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 3e-11
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 1e-08
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 2e-08
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 6e-07
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 8e-06
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 2e-12
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 3e-10
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 3e-09
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 2e-06
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 4e-05
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 1e-04
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 3e-04
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 3e-10
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-10
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-08
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 4e-08
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 1e-06
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 3e-05
1aut_L114 Activated protein C; serine proteinase, plasma cal 4e-10
1aut_L114 Activated protein C; serine proteinase, plasma cal 1e-08
1aut_L114 Activated protein C; serine proteinase, plasma cal 2e-08
1aut_L114 Activated protein C; serine proteinase, plasma cal 1e-07
1aut_L114 Activated protein C; serine proteinase, plasma cal 1e-06
2vh0_B134 Activated factor XA light chain; serine protease, 5e-10
2vh0_B134 Activated factor XA light chain; serine protease, 2e-09
2vh0_B134 Activated factor XA light chain; serine protease, 8e-09
2vh0_B134 Activated factor XA light chain; serine protease, 1e-07
2vh0_B134 Activated factor XA light chain; serine protease, 4e-07
2vh0_B134 Activated factor XA light chain; serine protease, 7e-05
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 7e-10
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 1e-07
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 2e-07
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 3e-06
3v65_B 386 Low-density lipoprotein receptor-related protein; 9e-10
3v65_B386 Low-density lipoprotein receptor-related protein; 1e-08
3v65_B 386 Low-density lipoprotein receptor-related protein; 1e-08
3v65_B 386 Low-density lipoprotein receptor-related protein; 2e-08
3v65_B 386 Low-density lipoprotein receptor-related protein; 2e-07
3v65_B386 Low-density lipoprotein receptor-related protein; 2e-05
3v65_B386 Low-density lipoprotein receptor-related protein; 1e-04
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 2e-09
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 3e-09
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 4e-07
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 2e-08
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 9e-08
3p5b_L400 Low density lipoprotein receptor variant; B-propel 1e-06
3p5b_L400 Low density lipoprotein receptor variant; B-propel 2e-05
3p5b_L400 Low density lipoprotein receptor variant; B-propel 4e-05
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 1e-04
3p5b_L400 Low density lipoprotein receptor variant; B-propel 2e-04
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 5e-07
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-06
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 6e-06
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 2e-04
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-06
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 3e-05
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 4e-05
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 6e-04
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 4e-05
1gl4_A 285 Nidogen-1, entactin; immunoglobulin-like domain, e 3e-04
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 5e-05
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 8e-05
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 9e-05
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 1e-04
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 2e-04
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 4e-04
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 6e-04
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 7e-04
1nzi_A159 Complement C1S component; calcium, innate immunity 3e-04
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 6e-04
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 8e-04
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
 Score =  131 bits (332), Expect = 1e-35
 Identities = 46/175 (26%), Positives = 66/175 (37%), Gaps = 18/175 (10%)

Query: 766 DLNECALMPSACQGGECINTDGSYRCECPAGYVKDETGKICIDDNECLSIPNICGNGTCT 825
           D+NEC   P+ C  G C+NT GSY C+CP  +  + T   C+D        N   +    
Sbjct: 2   DVNECL-DPTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSG----NCYLDIRPR 56

Query: 826 NLNGGFECTCSEGYAPGPLGSCAILLTLPPISPSTDIDECYERPGICANGDCANFQGSFQ 885
             NG   C+   G        C              + + +  P           +    
Sbjct: 57  GDNGDTACSNEIGVGVSKASCC------------CSLGKAWGTPCEM-CPAVNTSEYKIL 103

Query: 886 CTCANGYTLNTARDSCVDIDECARHPNICNNGTCVNAIGSFKCHCYAGFKLSHNN 940
           C    G+  N       DIDEC   P +C  G C+N  GSF+C C  G+ L+ + 
Sbjct: 104 CPGGEGFRPNPITVILEDIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDT 158
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Length = 162 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Length = 147 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Length = 86 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Length = 135 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Length = 82 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Length = 143 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Length = 107 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Length = 118 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Length = 186 Back     alignment and structure
>1apj_A Fibrillin; microfibril, TB module, marfan syndrome, connective tissue, novel fold, extracellular matrix; NMR {Homo sapiens} SCOP: g.23.1.1 Length = 74 Back     alignment and structure
>1apj_A Fibrillin; microfibril, TB module, marfan syndrome, connective tissue, novel fold, extracellular matrix; NMR {Homo sapiens} SCOP: g.23.1.1 Length = 74 Back     alignment and structure
>1apj_A Fibrillin; microfibril, TB module, marfan syndrome, connective tissue, novel fold, extracellular matrix; NMR {Homo sapiens} SCOP: g.23.1.1 Length = 74 Back     alignment and structure
>1ksq_A Latent transforming growth factor beta binding protein 1; structure, LTBP-1, TGF-beta, TB domain, latency associated propeptide, LAP; NMR {Homo sapiens} SCOP: g.23.1.1 Length = 75 Back     alignment and structure
>1ksq_A Latent transforming growth factor beta binding protein 1; structure, LTBP-1, TGF-beta, TB domain, latency associated propeptide, LAP; NMR {Homo sapiens} SCOP: g.23.1.1 Length = 75 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Length = 195 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Length = 634 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Length = 146 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Length = 114 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Length = 134 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Length = 142 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Length = 143 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Length = 400 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Length = 53 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Length = 39 Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Length = 91 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1050
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.77
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.77
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 99.77
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.76
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 99.76
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.75
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 99.73
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.73
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.73
2bou_A143 EGF-like module containing mucin-like hormone rece 99.71
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.69
1yo8_A634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 99.67
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.65
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.63
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.59
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 99.58
2bou_A143 EGF-like module containing mucin-like hormone rece 99.57
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.55
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 99.52
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.51
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.5
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.43
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 99.39
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 99.36
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.35
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.34
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.33
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 99.32
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.31
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.27
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 99.27
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.25
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.21
2vh0_B134 Activated factor XA light chain; serine protease, 99.19
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 99.17
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 99.16
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.13
1aut_L114 Activated protein C; serine proteinase, plasma cal 99.13
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 99.12
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 99.12
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.1
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 99.06
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 99.05
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 99.05
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.98
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.96
2vh0_B134 Activated factor XA light chain; serine protease, 98.95
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 98.92
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.88
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 98.87
3v65_B386 Low-density lipoprotein receptor-related protein; 98.81
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.8
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.77
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.72
3v65_B386 Low-density lipoprotein receptor-related protein; 98.72
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.71
3p5b_L400 Low density lipoprotein receptor variant; B-propel 98.67
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.65
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.58
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.55
1apj_A74 Fibrillin; microfibril, TB module, marfan syndrome 98.54
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.21
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 98.15
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.08
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 98.07
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 98.07
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 97.97
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.97
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.89
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.82
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.81
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.79
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.77
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 97.76
1ksq_A75 Latent transforming growth factor beta binding pro 97.76
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.76
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 97.72
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 97.68
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.62
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.58
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.57
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 97.54
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.53
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 97.5
2k2s_B61 Micronemal protein 6; microneme protein complex, c 97.45
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.36
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.32
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 97.28
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 97.28
2wph_E59 Coagulation factor IXA light chain; serine proteas 97.23
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.2
1a3p_A45 Epidermal growth factor; disulfide connectivities, 97.19
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.12
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 97.04
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 96.94
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.86
2wph_E59 Coagulation factor IXA light chain; serine proteas 96.85
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.83
1ob1_C99 Major merozoite surface protein; immune system, im 96.68
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 96.64
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 96.6
1apj_A74 Fibrillin; microfibril, TB module, marfan syndrome 96.59
1szb_A170 Mannose binding lectin-associated serine protease- 96.48
1szb_A170 Mannose binding lectin-associated serine protease- 96.26
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.26
1ob1_C99 Major merozoite surface protein; immune system, im 96.07
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 95.87
1nql_B53 Epidermal growth factor; cell surface receptor, ty 95.72
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 95.64
1ksq_A75 Latent transforming growth factor beta binding pro 95.19
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 95.11
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 94.75
1nql_B53 Epidermal growth factor; cell surface receptor, ty 94.69
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 94.66
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 94.4
1nzi_A159 Complement C1S component; calcium, innate immunity 94.19
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 93.92
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 93.84
1nzi_A159 Complement C1S component; calcium, innate immunity 93.52
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 93.12
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 92.86
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 92.62
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 92.53
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 91.47
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 91.38
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 90.9
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 90.22
1q4g_A553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 90.18
1q4g_A553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 89.6
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 89.58
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 89.38
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 89.22
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 87.87
3nt1_A587 Prostaglandin-endoperoxide synthase 2; prostagland 87.58
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 87.41
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 86.23
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 85.67
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 84.82
3cfw_A164 L-selectin; EGF, cell adhesion, EGF-like domain, g 84.47
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 84.28
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 83.43
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
Probab=99.77  E-value=4.7e-20  Score=186.17  Aligned_cols=158  Identities=36%  Similarity=0.874  Sum_probs=120.0

Q ss_pred             ccCccccCCCCCCCCCeeecCCCceEEecCCCeEeCCCCCccccCcc--ccccCCCCCccccCcccchhhhhcccCCcCC
Q psy18237        575 IDLDECRMMSYLCRNGRCRNNIGSFFCECLQGYTLASEGQYCRDVDE--CKEVNKRESRCYLDTEEEEEEEEEEEGGYGG  652 (1050)
Q Consensus       575 ~dideC~~~~~~C~ng~C~n~~gsy~C~C~~Gy~~~~~G~~C~~~~e--C~~~~~~~~~C~~~~~~c~~~~c~~~g~~~~  652 (1050)
                      +|||||+. +++|.+|+|+|++|+|+|.|++||+++++|++|+++++  |...+..          |.            
T Consensus         1 ~dideC~~-~~~C~~~~C~n~~gsy~C~C~~Gy~~~~~g~~C~d~~~~~C~~~~~~----------c~------------   57 (162)
T 1uzk_A            1 TDVNECLD-PTTCISGNCVNTPGSYICDCPPDFELNPTRVGCVDTRSGNCYLDIRP----------RG------------   57 (162)
T ss_dssp             CCCCGGGS-TTSSBTSEEEEETTEEEEECCTTCEECTTSSBEECCCCEEEEEEC--------------------------
T ss_pred             CccccCCC-CCCCCCCEeECCCCCEEEeCCCCCeECCCCCcccCCCCCcccCCCcc----------cC------------
Confidence            47999985 47898899999999999999999999999999998886  7654210          00            


Q ss_pred             CCCccccccCCCCCCCcceeecCCCCccCCCCCCCCCCCCCCCccccCCCCCCCCCCCCCCCCCCCCCEEeecCCCeEEe
Q psy18237        653 GSRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEECPAVGSDEHKTLCPGGSGYRPNSATREGICPSPGKCQNVMGSFICT  732 (1050)
Q Consensus       653 ~~~~~~C~~~~~~~~~~~~C~C~~G~~~G~~C~~c~~~~~~~~~~~Cp~g~g~~~~~~~~~~~C~~~g~C~~~~gsy~C~  732 (1050)
                      ...+++|.+..+...+.++|.|++||.|+..|+.|+                             .     +..++|+|+
T Consensus        58 ~~~~~~C~~~~~~~~~~~~C~C~~G~~~~~~C~~C~-----------------------------~-----~~~~~y~C~  103 (162)
T 1uzk_A           58 DNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMCP-----------------------------A-----VNTSEYKIL  103 (162)
T ss_dssp             ------CEEEEEEEECHHHHHTTTCCEETTTTEECC-----------------------------C-----TTSHHHHHH
T ss_pred             CCCCCcccCCcCCcccCceeeCCCCCCcCCCcccCC-----------------------------C-----CCCCCceeE
Confidence            012345555443334468899999998788776432                             1     135689999


Q ss_pred             CCC--CcccCCCCCcccccccccCCCCCCCCCCCCCCCccCCCCCCCCCCeEEeCCCCeeeeCCCCceeCCCCCccc
Q psy18237        733 CPP--GYRLSPDKNSCQEDFAKLCPEGVGRGDKGEDLNECALMPSACQGGECINTDGSYRCECPAGYVKDETGKICI  807 (1050)
Q Consensus       733 C~~--Gy~g~~~~~~C~~~~~c~C~~g~~~~~~~~~ideC~~~~~~C~~g~C~~~~gsy~C~C~~Gy~~~~~g~~C~  807 (1050)
                      |++  ||+++.....|+                  +||||...+++|.+++|+++.++|+|.|++||+++..++.|+
T Consensus       104 C~~g~G~~~~~~~~~c~------------------dideC~~~~~~C~~g~C~n~~gsy~C~C~~Gy~g~~d~~~C~  162 (162)
T 1uzk_A          104 CPGGEGFRPNPITVILE------------------DIDECQELPGLCQGGKCINTFGSFQCRCPTGYYLNEDTRVCD  162 (162)
T ss_dssp             CTTCTTEEECTTTCCEE------------------ECCHHHHCGGGGBTSEEEECSSCEEEECCTTCCBCTTTCBBC
T ss_pred             CCCCCCcccCCCCCccC------------------ccccccCCCCCcCCCEeEcCCCCEEeeCCCCccCCCCCCccC
Confidence            988  999976655555                  899998877779888999999999999999999887777763
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1apj_A Fibrillin; microfibril, TB module, marfan syndrome, connective tissue, novel fold, extracellular matrix; NMR {Homo sapiens} SCOP: g.23.1.1 Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1ksq_A Latent transforming growth factor beta binding protein 1; structure, LTBP-1, TGF-beta, TB domain, latency associated propeptide, LAP; NMR {Homo sapiens} SCOP: g.23.1.1 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1apj_A Fibrillin; microfibril, TB module, marfan syndrome, connective tissue, novel fold, extracellular matrix; NMR {Homo sapiens} SCOP: g.23.1.1 Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>1ksq_A Latent transforming growth factor beta binding protein 1; structure, LTBP-1, TGF-beta, TB domain, latency associated propeptide, LAP; NMR {Homo sapiens} SCOP: g.23.1.1 Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1050
d1uzka376 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapi 3e-16
d1uzka376 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapi 6e-11
d1uzka376 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapi 2e-07
d1apja_74 g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [Tax 4e-14
d1apja_74 g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [Tax 4e-13
d1apja_74 g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [Tax 1e-08
d1ksqa_75 g.23.1.1 (A:) Transforming growth factor-beta bind 4e-14
d1ksqa_75 g.23.1.1 (A:) Transforming growth factor-beta bind 4e-11
d1ksqa_75 g.23.1.1 (A:) Transforming growth factor-beta bind 1e-05
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 1e-08
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 1e-08
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 1e-07
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 2e-07
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 4e-07
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 8e-07
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 2e-06
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 4e-06
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 8e-05
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 1e-04
d1lmja242 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapien 0.001
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 2e-08
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 3e-08
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 3e-07
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 4e-07
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 6e-07
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 9e-07
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 3e-06
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 1e-05
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 1e-04
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 2e-04
d1uzka243 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sa 4e-04
d1emoa239 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sa 1e-07
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 2e-07
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 9e-07
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 3e-06
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 7e-06
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 2e-05
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 1e-04
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 2e-04
d1uzka143 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sa 4e-04
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 3e-07
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 7e-07
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 1e-06
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 2e-06
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 5e-06
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 5e-06
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 2e-05
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 2e-05
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 4e-05
d1lmja144 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens 3e-04
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 1e-06
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 5e-06
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 2e-05
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 7e-05
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 2e-04
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 3e-04
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 6e-04
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 8e-04
d1emoa143 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sa 0.002
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 2e-05
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 2e-04
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 2e-04
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 7e-04
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 8e-04
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 8e-04
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 0.002
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 0.002
d1apqa_53 g.3.11.1 (A:) Complement protease C1R {Human (Homo 0.002
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 2e-05
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 3e-04
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 8e-04
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 0.001
d1i0ua241 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) r 0.002
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 4e-05
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 7e-05
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 1e-04
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 0.001
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 0.002
d1szba245 g.3.11.1 (A:124-168) Mannose-binding protein assoc 0.002
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 4e-05
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 5e-05
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 1e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 2e-04
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 0.003
d2vj3a142 g.3.11.1 (A:411-452) Neurogenic locus notch homolo 0.004
d1dx5i340 g.3.11.1 (I:423-462) Thrombomodulin, different EGF 2e-04
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 3e-04
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 7e-04
d1nt0a345 g.3.11.1 (A:120-164) Mannose-binding protein assoc 0.004
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 4e-04
d1kigl_51 g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bo 0.001
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 5e-04
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 0.001
d1nzia242 g.3.11.1 (A:118-159) Complement C1S component {Hum 0.003
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 0.001
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 0.003
d1autl250 g.3.11.1 (L:97-146) Activated protein c (autoproth 0.004
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 0.001
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 0.002
d2p3ua151 g.3.11.1 (A:87-137) Factor X, N-terminal module {H 0.004
d1edmb_39 g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens 0.002
>d1uzka3 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

class: Small proteins
fold: TB module/8-cys domain
superfamily: TB module/8-cys domain
family: TB module/8-cys domain
domain: Fibrillin
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 72.3 bits (177), Expect = 3e-16
 Identities = 36/84 (42%), Positives = 46/84 (54%), Gaps = 12/84 (14%)

Query: 628 RESRCYLDTEEEEEEEEEEEGGYGGGSRRVTCTKEIAGSTTRSTCCCSIGKAWGPQCEEC 687
           R   CYLD                G +    C+ EI    ++++CCCS+GKAWG  CE C
Sbjct: 2   RSGNCYLDIRPR------------GDNGDTACSNEIGVGVSKASCCCSLGKAWGTPCEMC 49

Query: 688 PAVGSDEHKTLCPGGSGYRPNSAT 711
           PAV + E+K LCPGG G+RPN  T
Sbjct: 50  PAVNTSEYKILCPGGEGFRPNPIT 73
>d1uzka3 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1uzka3 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1apja_ g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1apja_ g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1apja_ g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1ksqa_ g.23.1.1 (A:) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1ksqa_ g.23.1.1 (A:) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1ksqa_ g.23.1.1 (A:) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 43 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Length = 40 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 45 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Length = 51 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1050
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1apja_74 Fibrillin {Human (Homo sapiens) [TaxId: 9606]} 98.78
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.77
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.71
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.69
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.63
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.58
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.57
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.5
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.49
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.47
d1uzka376 Fibrillin {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1szba245 Mannose-binding protein associated serine protease 98.44
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.43
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 98.39
d1nt0a345 Mannose-binding protein associated serine protease 98.37
d1ksqa_75 Transforming growth factor-beta binding protein-1 98.3
d1i0ua241 Low density lipoprotein (LDL) receptor, different 98.25
d1szba245 Mannose-binding protein associated serine protease 98.24
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.2
d1nt0a345 Mannose-binding protein associated serine protease 98.2
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.18
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.16
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 98.15
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.13
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 98.12
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 98.1
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 98.07
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 98.03
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 98.03
d3bpse140 Low density lipoprotein (LDL) receptor, different 98.0
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.95
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.89
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.84
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.82
d3bpse140 Low density lipoprotein (LDL) receptor, different 97.81
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.79
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 97.78
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 97.76
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.73
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.53
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.51
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 97.51
d1uzka376 Fibrillin {Human (Homo sapiens) [TaxId: 9606]} 97.48
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.44
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 97.44
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.43
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.4
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.37
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 97.32
d1apja_74 Fibrillin {Human (Homo sapiens) [TaxId: 9606]} 97.31
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.3
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 97.29
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.27
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 97.23
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 97.12
d1ijqa250 Low density lipoprotein (LDL) receptor, different 97.11
d1ksqa_75 Transforming growth factor-beta binding protein-1 97.09
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 97.03
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 96.99
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 96.82
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.66
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 96.63
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.53
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 96.45
d1ijqa250 Low density lipoprotein (LDL) receptor, different 96.27
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 96.19
d1rfnb_57 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.15
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 95.71
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 95.36
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 94.61
d2bz6l153 Coagulation factor VIIa {Human (Homo sapiens) [Tax 94.59
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 94.46
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 94.4
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 92.57
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 90.81
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 89.61
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 85.92
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 85.51
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 85.21
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Fibrillin-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.84  E-value=5.1e-10  Score=82.26  Aligned_cols=42  Identities=45%  Similarity=0.947  Sum_probs=37.7

Q ss_pred             cCccCcCCCCCCCCCeEeecCCceEEeCCCCCeeCCCCCccc
Q psy18237        307 DIDECATSIQRCGEGFCVNDVGTYHCVCPDGYMLLPSGKECI  348 (1050)
Q Consensus       307 dideC~~~~~~C~~~~C~n~~Gsy~C~C~~G~~g~~~~~~C~  348 (1050)
                      |||||+..++.|.+++|+|++|||+|.|++||+...+++.|+
T Consensus         1 DidEC~~~~~~C~~~~C~Nt~Gsy~C~C~~Gy~l~~d~~~Cv   42 (42)
T d1lmja2           1 DIDECQRDPLLCRGGVCHNTEGSYRCECPPGHQLSPNISACI   42 (42)
T ss_dssp             ECCHHHHCSSTTTTSEEEEETTEEEEESCTTSCCCSSSCCCC
T ss_pred             CccccCCCCCCCCCCEeECCCCCeEEeCCCCCeECcCCCccC
Confidence            789998888899889999999999999999999987777763
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apja_ g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka3 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ksqa_ g.23.1.1 (A:) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka3 g.23.1.1 (A:1529-1604) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apja_ g.23.1.1 (A:) Fibrillin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksqa_ g.23.1.1 (A:) Transforming growth factor-beta binding protein-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure