Diaphorina citri psyllid: psy18241

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560------
MPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQCHLCGKGFIHHTSYKFHQLVHSGERNVKCDICGLALTTKSHLNRHMLVHTGDRPHECSVCGKRFAKKWNAQVHKKKVHGLDVPGTTHRVMPVPPIGGGEKEEDVATTDTEDDVPSIKIKFLSALIYFFVSWTFWPLVSQECFLTIGFFFFLTGERACMPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQWEQSHLNYVWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSFYIHKMVHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQAL
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQCHLCGKGFIHHTSYKFHQLVHSGERNVKCDICGLALTTKSHLNRHMLVHTGDRPHECSVCGKRFAKKWNAQVHKKKVHGLDVPGTTHRVMPVPPIG**EKEEDVATTDTEDDVPSIKIKFLSALIYFFVSWTFWPLVSQECFLTIGFFFFLTGERACMPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQWEQSHLNYVWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSFYIHKMVHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQAL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQCHLCGKGFIHHTSYKFHQLVHSGERNVKCDICGLALTTKSHLNRHMLVHTGDRPHECSVCGKRFAKKWNAQVHKKKVHGLDVPGTTHRVMPVPPIGGGEKEEDVATTDTEDDVPSIKIKFLSALIYFFVSWTFWPLVSQECFLTIGFFFFLTGERACMPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQWEQSHLNYVWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSFYIHKMVHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger protein 585A May be involved in transcriptional regulation.confidentQ6P3V2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EE8, chain A
Confidence level:very confident
Coverage over the Query: 474-565
View the alignment between query and template
View the model in PyMOL
Template: 2EE8, chain A
Confidence level:very confident
Coverage over the Query: 393-478
View the alignment between query and template
View the model in PyMOL
Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 375-529
View the alignment between query and template
View the model in PyMOL
Template: 2KMK, chain A
Confidence level:very confident
Coverage over the Query: 60-141
View the alignment between query and template
View the model in PyMOL
Template: 1LLM, chain C
Confidence level:very confident
Coverage over the Query: 86-169
View the alignment between query and template
View the model in PyMOL
Template: 3HCS, chain A
Confidence level:probable
Coverage over the Query: 3-17,33-168
View the alignment between query and template
View the model in PyMOL