Psyllid ID: psy18241


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560------
MPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQCHLCGKGFIHHTSYKFHQLVHSGERNVKCDICGLALTTKSHLNRHMLVHTGDRPHECSVCGKRFAKKWNAQVHKKKVHGLDVPGTTHRVMPVPPIGGGEKEEDVATTDTEDDVPSIKIKFLSALIYFFVSWTFWPLVSQECFLTIGFFFFLTGERACMPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQWEQSHLNYVWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSFYIHKMVHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQAL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccEEccccHHHHHEHcccccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHcccccccccccccccEccccccHEEEccccccccccccEEcccccHHEHEHHcccccccccccccccEcccccHHEHEcEcccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccEccccccccEEEccccHHHHHHHccccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEEccccHHHHHHHcccccccEcc
mplihecptcgkkwRTVSELNAHIqthsdlrpfvceicgqgyKMKKALLVHVGmhsgihpftchfcnksftQKIGLVKhlnihngtkkyqchlcgkgfihhtsyKFHQLVHsgernvkcdicglalttkshLNRHmlvhtgdrphecsvcgkrFAKKWNAQVHKkkvhgldvpgtthrvmpvppigggekeedvattdteddvpsIKIKFLSALIYFFVSWtfwplvsqecFLTIGFFFFLtgeracmplihecptcgkkwRTVSELNAHIqthsdlrpfvceicgqgyKMKKALLVHVGmhnginpftcsfcnksftqkvglqkhlpihtgstrfqWEQSHLNYVWRTVSELNAHiqthsdlrpfvceicgqgyKMKKALLVHVGmhnginpftcsfcnksftqkvglqkhlpihtgstrfqcdlcgkrfihqkSFYIHKmvhsgekpikcsacglavlssshlkrhfrvhtgekpyqcttcgkrLRRTVSELNAHIqthsdlrpfvceicgqgyKMKKALLVHVGmhsgihpftchfcnksftQKIGLVKhlnihngtkkyqal
mplihecptcgkKWRTVSELNAHiqthsdlrPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQCHLCGKGFIHHTSYKFHQLVHSGERNVKCDICGLALTTKSHLNRHMLVHTGDRPHECSVCGKRFAKKWNAQVHKKkvhgldvpgtthrvmpvppigggekeedvattdteddvPSIKIKFLSALIYFFVSWTFWPLVSQECFLTIGFFFFLTGERACMPLIHECPTCGKKWRTVSELNAHiqthsdlrPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQWEQSHLNYVWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSFYIHKMVHSGEKPIKCSACGLAVLSSSHLKRhfrvhtgekpyqcttcgkRLRRTVSELNAhiqthsdlrpFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKhlnihngtkkyqal
MPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQCHLCGKGFIHHTSYKFHQLVHSGERNVKCDICGLALTTKSHLNRHMLVHTGDRPHECSVCGKRFAKKWNAQVHKKKVHGLDVPGTTHRVMPVPPIGGGekeedvattdteddVPSIKIKFLSALIYFFVSWTFWPLVSQECfltigffffltgERACMPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQWEQSHLNYVWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSFYIHKMVHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQAL
***IHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQCHLCGKGFIHHTSYKFHQLVHSGERNVKCDICGLALTTKSHLNRHMLVHTGDRPHECSVCGKRFAKKWNAQVHKKKVHGLDVPGTTH*************************VPSIKIKFLSALIYFFVSWTFWPLVSQECFLTIGFFFFLTGERACMPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQWEQSHLNYVWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSFYIHKMVHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHN********
MPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQCHLCGKGFIHHTSYKFHQLVHSGERNVKCDICGLALTTKSHLNRHMLVHTGDRPHECSVCGKRFAKKWNAQVHKKKVHGLDVPGTTHRVMPVPPIG**EKEEDVATTDTEDDVPSIKIKFLSALIYFFVSWTFWPLVSQECFLTIGFFFFLTGERACMPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQWEQSHLNYVWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSFYIHKMVHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQAL
MPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQCHLCGKGFIHHTSYKFHQLVHSGERNVKCDICGLALTTKSHLNRHMLVHTGDRPHECSVCGKRFAKKWNAQVHKKKVHGLDVPGTTHRVMPVPPIGGG*************DVPSIKIKFLSALIYFFVSWTFWPLVSQECFLTIGFFFFLTGERACMPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQWEQSHLNYVWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSFYIHKMVHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQAL
**LIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQCHLCGKGFIHHTSYKFHQLVHSGERNVKCDICGLALTTKSHLNRHMLVHTGDRPHECSVCGKRFAKKWNAQVHKKKVHGLDVPGTTHRVMPVPPIGGGEKEEDVATTDTEDDVPSIKIKFLSALIYFFVSWTFWPLVSQECFLTIGFFFFLTGERACMPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQWEQSHLNYVWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSFYIHKMVHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQAL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQCHLCGKGFIHHTSYKFHQLVHSGERNVKCDICGLALTTKSHLNRHMLVHTGDRPHECSVCGKRFAKKWNAQVHKKKVHGLDVPGTTHRVMPVPPIGGGEKEEDVATTDTEDDVPSIKIKFLSALIYFFVSWTFWPLVSQECFLTIGFFFFLTGERACMPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQWEQSHLNYVWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSFYIHKMVHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKYQAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query566 2.2.26 [Sep-21-2011]
P10076861 Zinc finger protein 26 OS no N/A 0.968 0.636 0.333 6e-91
Q96IR2970 Zinc finger protein 845 O no N/A 0.952 0.555 0.324 5e-90
A6NN141173 Zinc finger protein 729 O no N/A 0.966 0.466 0.328 5e-86
Q9P2J8865 Zinc finger protein 624 O no N/A 0.950 0.621 0.329 2e-85
Q6P3V2769 Zinc finger protein 585A yes N/A 0.945 0.695 0.333 2e-85
Q9HCG1818 Zinc finger protein 160 O no N/A 0.932 0.645 0.309 7e-85
A8MQ14 1090 Zinc finger protein 850 O no N/A 0.973 0.505 0.323 2e-84
Q5RDX1737 Zinc finger protein 585A no N/A 0.969 0.744 0.320 3e-84
Q86UE3836 Zinc finger protein 546 O no N/A 0.929 0.629 0.328 4e-84
Q8NB50 900 Zinc finger protein 62 ho no N/A 0.925 0.582 0.330 8e-84
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function desciption
 Score =  335 bits (859), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 201/602 (33%), Positives = 295/602 (49%), Gaps = 54/602 (8%)

Query: 5   HECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCH 64
           +EC  C K +     LN H+Q+H+  +P+ C+ CG+ +  + +L+VH+  H+    + C 
Sbjct: 246 YECKKCEKFFTHPVYLNIHMQSHTVEKPYDCKECGKAFTERSSLIVHLRQHTREKSYECK 305

Query: 65  FCNKSFTQKIGLVKHLNIHNGTKKYQCHLCGKGFIHHTSYKFHQLVHSGERNVKCDICGL 124
            C K+F Q   L +H+  H G K YQC  CG  F   +    H   H+GE+  +C+ICG 
Sbjct: 306 ECGKTFIQPSRLTEHMRSHTGEKPYQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGK 365

Query: 125 ALTTKSHLNRHMLVHTGDRPHECSVCGKRFAKKWNAQVHKKKVHGLDVPGTTHRVMPVPP 184
           A T  S+L  H+  HTG++P+EC VCGK F+ +    +H +K  G        R  P   
Sbjct: 366 AFTRSSYLLGHIRTHTGEKPYECKVCGKAFSGRSWLTIHLRKHTG-------ERPYPCTE 418

Query: 185 -----IGGGEKEEDVATTDTED----DVPSIKIKFLSAL-IYFFVSWTFWPLVSQECFLT 234
                    +  E + T   E      V +   +  S L  +F +     P     C   
Sbjct: 419 CEKAFTSFAQLTEHIKTHTGEKPFRCKVCARTFRNSSCLKTHFRIHTGIKPYKCNYC--- 475

Query: 235 IGFFFFLTGERACMPLIH------ECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQG 288
            G  F          LIH      EC  CGK + T S L  HI+ H+  +PF C  CG+ 
Sbjct: 476 -GKAFTARSGLTKHVLIHNGEKPYECKECGKAFSTSSGLVEHIRIHTGEKPFECYQCGKA 534

Query: 289 YKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQWEQSHLNYVWR 348
                +L+ H+  H G  PF C+ C+K+FT+   L+ H+  HTG   ++ ++    +  R
Sbjct: 535 LAHSSSLVGHLRTHTGEKPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPER 594

Query: 349 --------------------------TVSELNAHIQTHSDLRPFVCEICGQGYKMKKALL 382
                                     + ++L  HI+THS  RPF C++C + ++   +L 
Sbjct: 595 SCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTHSSERPFQCKVCTKSFRNSSSLE 654

Query: 383 VHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSFYIHKM 442
            H  +H G+ P+ CS+C K+FT + GL  HL  HTG   + C  CGK F        H  
Sbjct: 655 THFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIR 714

Query: 443 VHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSELNAHIQTHS 502
            H GEKP +C  CG A  SSS+L  H ++HTGEKP+QCT CGK      S L  H++TH+
Sbjct: 715 SHKGEKPFECDHCGKAFASSSYLNVHLKIHTGEKPFQCTVCGKTF-TCSSYLPVHMRTHT 773

Query: 503 DLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKK 562
             +PF C ICG+ +     L VH+ +H+G  P+ C +C K+FT+  GL KHL  H G K 
Sbjct: 774 GEKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLRKHTGEKP 833

Query: 563 YQ 564
           Y+
Sbjct: 834 YE 835




May be involved in transcriptional regulation.
Mus musculus (taxid: 10090)
>sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 Back     alignment and function description
>sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=3 Back     alignment and function description
>sp|Q9P2J8|ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens GN=ZNF624 PE=2 SV=3 Back     alignment and function description
>sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 Back     alignment and function description
>sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 Back     alignment and function description
>sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 Back     alignment and function description
>sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 Back     alignment and function description
>sp|Q86UE3|ZN546_HUMAN Zinc finger protein 546 OS=Homo sapiens GN=ZNF546 PE=2 SV=2 Back     alignment and function description
>sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query566
326667465 2943 PREDICTED: hypothetical protein LOC57172 0.931 0.179 0.350 6e-97
326667106 941 PREDICTED: zinc finger protein 729-like 0.938 0.564 0.357 5e-95
326676531 711 PREDICTED: zinc finger protein 850 [Dani 0.938 0.746 0.332 2e-94
326667187 1365 PREDICTED: zinc finger protein 729-like 0.888 0.368 0.355 5e-94
449267327 979 Zinc finger protein 91, partial [Columba 0.925 0.535 0.367 7e-94
326667255 908 PREDICTED: zinc finger protein 91-like [ 0.938 0.584 0.350 1e-93
326666993657 PREDICTED: zinc finger protein 721-like 0.966 0.832 0.346 2e-93
395518442 866 PREDICTED: zinc finger protein 850-like, 0.931 0.608 0.333 2e-93
326673951 810 PREDICTED: zinc finger protein 850-like 0.957 0.669 0.344 2e-93
338710162 1243 PREDICTED: zinc finger protein 226-like 0.961 0.437 0.336 9e-93
>gi|326667465|ref|XP_700431.5| PREDICTED: hypothetical protein LOC571721 [Danio rerio] Back     alignment and taxonomy information
 Score =  361 bits (926), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 199/567 (35%), Positives = 300/567 (52%), Gaps = 40/567 (7%)

Query: 5    HECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCH 64
            ++C  CGK +    +L  H+  H+ + PF C+ CG+ +  K+ L VH+ +H+G  P+ C 
Sbjct: 714  YQCRQCGKSFSQKIQLEGHMGVHTGVNPFTCQQCGKSFNRKQNLKVHIRVHTGEKPYQCQ 773

Query: 65   FCNKSFTQKIGLVKHLNIHNGTKKYQCHLCGKGFIHHTSYKFHQLVHSGERNVKCDICGL 124
             C KSF+Q+  L  HL IH G   + C  CGK F H  + + H  +H+GE+  +C  CG 
Sbjct: 774  QCGKSFSQQKNLDSHLVIHTGANPFVCQQCGKSFNHKQNLQVHMRIHTGEKPYQCRQCGR 833

Query: 125  ALTTKSHLNRHMLVHTGDRPHECSVCGKRFAKKWNAQVHKKKVHGLDVPGTTHRVMPVPP 184
            + + K+HL  HM +HTGD+P++C  CGK F  K N +VH + VH  + P           
Sbjct: 834  SFSQKTHLEIHMRIHTGDKPNQCQQCGKSFIHKQNLKVHMR-VHTGEKP------YHCQH 886

Query: 185  IGGGEKEEDVATTDTEDDVPSIKIKFLSALIYFFVSWTFWPLVSQECFLTIGFFFFL--- 241
             G    ++    T+ E               +  +     P   QEC  +      L   
Sbjct: 887  CGKSFSQQ----TNLEG--------------HMRIHSGVKPFTCQECGKSFVHKHNLQLH 928

Query: 242  ----TGERACMPLIHECPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLV 297
                TGE+   P   +C  CGK +     L  H++ H+  +PF C+ CG+G+ ++K L  
Sbjct: 929  LRVHTGEK---PF--KCQHCGKGFVHKHNLQLHLRVHTGEKPFKCQHCGKGFSLQKNLDG 983

Query: 298  HVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQWEQSHLNYVWRTVSELNAHI 357
            HV +H G  PF+C  C KSF  K   + H+ +HTG   +Q +Q    +  +  + L+ H+
Sbjct: 984  HVRIHTGEKPFSCPQCGKSFIDKQNFKVHMRVHTGEKPYQCQQCGKGFSLK--ASLDCHM 1041

Query: 358  QTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHT 417
              H+ L+PFVC+ CG+ +  +  L +H   H G  PFTC  C KSF QK  L+ H+ +HT
Sbjct: 1042 SIHTGLKPFVCQQCGKSFHQRPKLKLHRRTHTGEKPFTCQHCGKSFAQKQNLKVHMRVHT 1101

Query: 418  GSTRFQCDLCGKRFIHQKSFYIHKMVHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKP 477
              T + C  CG+ F  + +  IH+++H+GEKP  C  CG +      LK H R+HTGEKP
Sbjct: 1102 RETPYTCQYCGRSFNQKTNLEIHRIIHTGEKPFTCQQCGKSFSQKQTLKVHMRIHTGEKP 1161

Query: 478  YQCTTCGKRLRRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTC 537
            + C  CGK        L  H++ H+  +P++C +CG+ +  K +L VHVG+H+G  P+ C
Sbjct: 1162 FSCHHCGKTF-TDKQNLMVHMRIHTGDKPYICTVCGKNFSQKPSLDVHVGIHTGEKPYQC 1220

Query: 538  HFCNKSFTQKIGLVKHLNIHNGTKKYQ 564
              C KSF +K  L  H++IHNG K YQ
Sbjct: 1221 QQCGKSFNRKQNLQVHMSIHNGDKPYQ 1247




Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|326667106|ref|XP_003198487.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|326676531|ref|XP_003200602.1| PREDICTED: zinc finger protein 850 [Danio rerio] Back     alignment and taxonomy information
>gi|326667187|ref|XP_001920997.3| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|449267327|gb|EMC78282.1| Zinc finger protein 91, partial [Columba livia] Back     alignment and taxonomy information
>gi|326667255|ref|XP_003198540.1| PREDICTED: zinc finger protein 91-like [Danio rerio] Back     alignment and taxonomy information
>gi|326666993|ref|XP_003198445.1| PREDICTED: zinc finger protein 721-like [Danio rerio] Back     alignment and taxonomy information
>gi|395518442|ref|XP_003763370.1| PREDICTED: zinc finger protein 850-like, partial [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|326673951|ref|XP_003200036.1| PREDICTED: zinc finger protein 850-like [Danio rerio] Back     alignment and taxonomy information
>gi|338710162|ref|XP_003362321.1| PREDICTED: zinc finger protein 226-like [Equus caballus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query566
ZFIN|ZDB-GENE-110914-6789 si:dkey-77p23.3 "si:dkey-77p23 0.542 0.389 0.429 2.1e-109
ZFIN|ZDB-GENE-110914-160 1003 si:dkey-240n22.7 "si:dkey-240n 0.542 0.306 0.377 3.3e-67
ZFIN|ZDB-GENE-110913-157 981 si:ch211-245n8.1 "si:ch211-245 0.542 0.312 0.409 1.9e-106
ZFIN|ZDB-GENE-110913-159 733 si:ch211-197f20.2 "si:ch211-19 0.542 0.418 0.403 5.9e-101
ZFIN|ZDB-GENE-120214-24704 si:dkey-195o9.2 "si:dkey-195o9 0.542 0.436 0.403 2.8e-105
ZFIN|ZDB-GENE-110913-135689 si:ch211-207e19.14 "si:ch211-2 0.542 0.445 0.4 5.8e-105
ZFIN|ZDB-GENE-110913-173 819 si:dkey-78k22.1 "si:dkey-78k22 0.542 0.374 0.396 4.2e-98
ZFIN|ZDB-GENE-110913-38987 si:ch211-208f21.5 "si:ch211-20 0.547 0.314 0.389 1.9e-104
ZFIN|ZDB-GENE-110914-127580 si:dkey-54f18.1 "si:dkey-54f18 0.542 0.529 0.403 4e-104
ZFIN|ZDB-GENE-071004-105 1014 zgc:173573 "zgc:173573" [Danio 0.544 0.303 0.390 1.5e-103
ZFIN|ZDB-GENE-110914-6 si:dkey-77p23.3 "si:dkey-77p23.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 712 (255.7 bits), Expect = 2.1e-109, Sum P(2) = 2.1e-109
 Identities = 133/310 (42%), Positives = 173/310 (55%)

Query:   254 CPTCGKKWRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHNGINPFTCSFC 313
             C  CGK +   S LN HI +H+  +PF C  CG+ +    +L +H+  H G  PFTC+ C
Sbjct:   482 CTQCGKSFIRSSSLNLHIMSHTGEKPFTCTQCGKSFIRSSSLNLHIMSHTGEKPFTCTQC 541

Query:   314 NKSFTQKVGLQKHLPIHTGSTRFQWEQSHLNYVWRTVSELNAHIQTHSDLRPFVCEICGQ 373
               SFT+   L +H+  HTG   F   Q   +++ R+ S LN HI +H+  +PF C  CG 
Sbjct:   542 GNSFTRSSHLNRHMRNHTGEKPFTCTQCGKSFI-RS-SSLNLHIMSHTGEKPFTCTQCGN 599

Query:   374 GYKMKKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIH 433
              +     L  H+  H G  PFTC+ C KSF+Q   L KH+ IHTG   F C  CGK FI 
Sbjct:   600 SFTRSSHLNRHMRNHTGEKPFTCTQCGKSFSQSSNLNKHMKIHTGEKPFTCTQCGKSFIR 659

Query:   434 QKSFYIHKMVHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSE 493
               S  +H M H+GEKP  C+ CG +   SSHL RH R HTGEKP+ CT CGK   R+ S 
Sbjct:   660 SSSLNLHIMSHTGEKPFTCTQCGNSFTRSSHLNRHMRNHTGEKPFTCTQCGKSFIRS-SS 718

Query:   494 LNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKH 553
             LN HI +H+  +PF C  CG  +     L  H+  H+G  PFTC  C KSF+Q   L  H
Sbjct:   719 LNLHIMSHTGEKPFTCTQCGNSFTRSSHLNRHMRNHTGEKPFTCTQCGKSFSQSSNLNLH 778

Query:   554 LNIHNGTKKY 563
             + IH G K +
Sbjct:   779 MRIHTGEKPF 788


GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
ZFIN|ZDB-GENE-110914-160 si:dkey-240n22.7 "si:dkey-240n22.7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-157 si:ch211-245n8.1 "si:ch211-245n8.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-159 si:ch211-197f20.2 "si:ch211-197f20.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120214-24 si:dkey-195o9.2 "si:dkey-195o9.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-135 si:ch211-207e19.14 "si:ch211-207e19.14" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-173 si:dkey-78k22.1 "si:dkey-78k22.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-38 si:ch211-208f21.5 "si:ch211-208f21.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-127 si:dkey-54f18.1 "si:dkey-54f18.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-105 zgc:173573 "zgc:173573" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6P3V2Z585A_HUMANNo assigned EC number0.33330.94520.6957yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query566
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 4e-04
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 8e-04
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 37.4 bits (87), Expect = 4e-04
 Identities = 15/23 (65%), Positives = 18/23 (78%)

Query: 464 HLKRHFRVHTGEKPYQCTTCGKR 486
           +L+RH R HTGEKPY+C  CGK 
Sbjct: 1   NLRRHMRTHTGEKPYKCPVCGKS 23


Length = 26

>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 566
KOG1074|consensus958 100.0
KOG1074|consensus958 99.97
KOG2462|consensus279 99.97
KOG2462|consensus279 99.96
KOG3608|consensus467 99.96
KOG3608|consensus467 99.93
KOG3623|consensus 1007 99.92
KOG3623|consensus 1007 99.91
KOG3576|consensus267 99.77
KOG3576|consensus267 99.75
PLN03086567 PRLI-interacting factor K; Provisional 99.4
PLN03086567 PRLI-interacting factor K; Provisional 99.37
PHA00733128 hypothetical protein 99.27
PHA00733128 hypothetical protein 99.2
PHA0276855 hypothetical protein; Provisional 99.08
PHA0276855 hypothetical protein; Provisional 98.99
KOG3993|consensus500 98.93
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.86
KOG3993|consensus500 98.79
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.72
PHA0061644 hypothetical protein 98.59
PHA0061644 hypothetical protein 98.55
PHA0073279 hypothetical protein 98.51
PHA0073279 hypothetical protein 98.33
KOG1146|consensus1406 98.21
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.16
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.07
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.89
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.84
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.74
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.66
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.48
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.45
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.44
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.4
COG5189423 SFP1 Putative transcriptional repressor regulating 97.39
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.38
COG5189423 SFP1 Putative transcriptional repressor regulating 97.32
smart0035526 ZnF_C2H2 zinc finger. 97.12
COG5048467 FOG: Zn-finger [General function prediction only] 97.06
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.04
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.97
KOG2231|consensus669 96.85
smart0035526 ZnF_C2H2 zinc finger. 96.73
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.61
PRK04860160 hypothetical protein; Provisional 96.56
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.52
KOG1146|consensus1406 96.42
KOG2231|consensus669 96.39
PRK04860160 hypothetical protein; Provisional 96.37
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.22
KOG2785|consensus390 96.2
COG5048467 FOG: Zn-finger [General function prediction only] 96.16
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.94
COG5236493 Uncharacterized conserved protein, contains RING Z 95.59
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.59
COG5236493 Uncharacterized conserved protein, contains RING Z 95.08
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.54
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.36
KOG2785|consensus390 94.31
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 93.61
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.75
KOG2482|consensus423 92.67
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 92.47
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.6
KOG4173|consensus253 91.51
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 91.42
KOG2893|consensus341 90.99
KOG2893|consensus 341 90.97
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 90.03
KOG2482|consensus423 87.1
KOG4173|consensus253 85.73
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 85.11
COG404965 Uncharacterized protein containing archaeal-type C 84.69
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 84.03
COG404965 Uncharacterized protein containing archaeal-type C 83.74
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 83.07
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 82.94
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 82.7
PF1371736 zinc_ribbon_4: zinc-ribbon domain 80.65
>KOG1074|consensus Back     alignment and domain information
Probab=100.00  E-value=1.8e-36  Score=296.09  Aligned_cols=57  Identities=35%  Similarity=0.773  Sum_probs=54.7

Q ss_pred             ccCCCCCCcccCchhHHhHhhhccCCCcccCCcChhhccChhhHHHHHhhhcCCCCC
Q psy18241        507 FVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNGTKKY  563 (566)
Q Consensus       507 ~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~  563 (566)
                      ..|.+||+.|...++|..||++|+|+|||.|.+|++.|..+.+|+.||.+|+...++
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~  936 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPP  936 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCCC
Confidence            789999999999999999999999999999999999999999999999999987665



>KOG1074|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query566
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 6e-33
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 4e-15
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-13
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-10
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 7e-15
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 4e-12
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 8e-11
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 4e-12
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 4e-12
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 3e-11
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 8e-11
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-11
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-05
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-11
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-09
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-11
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-04
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-11
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-10
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-06
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 7e-11
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 7e-05
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 8e-11
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 7e-05
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 8e-11
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 5e-05
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 8e-11
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-10
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-05
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 8e-11
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-05
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 8e-11
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 6e-05
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 2e-10
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 4e-09
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 2e-10
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 2e-04
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-10
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 1e-08
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 6e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 3e-10
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 7e-07
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 6e-10
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-09
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 8e-10
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 9e-10
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 2e-09
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 4e-06
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 4e-05
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 5e-09
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-05
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 7e-09
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 2e-08
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 2e-04
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 6e-07
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 4e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 3e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 6e-05
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 5e-05
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 3e-04
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 7e-05
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 6e-04
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 1e-04
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 1e-04
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 1e-04
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 2e-04
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 2e-04
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 3e-04
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 3e-04
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 6e-04
2ytk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2ytr_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2yts_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 9e-04
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 9e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 138 bits (348), Expect = 6e-33, Method: Compositional matrix adjust. Identities = 66/182 (36%), Positives = 97/182 (53%), Gaps = 1/182 (0%) Query: 380 ALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSFYI 439 + + + G P+ C C KSF++ L +H HTG ++C CGK F +K Sbjct: 8 SSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTR 67 Query: 440 HKMVHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSELNAHIQ 499 H+ H+GEKP KC CG + ++L+ H R HTGEKPY C CGK + ++ L AH + Sbjct: 68 HQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQ-LAHLRAHQR 126 Query: 500 THSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIHNG 559 TH+ +P+ C CG+ + + L H H+G P+ C C KSF+++ L H H G Sbjct: 127 THTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTG 186 Query: 560 TK 561 K Sbjct: 187 KK 188
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2YTK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 396- 428) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 760- 792) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTS|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 715- 747) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query566
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-44
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-40
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-40
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-39
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-39
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-35
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-32
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-29
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-27
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-22
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-32
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-30
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-29
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-28
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-19
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-19
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-17
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 2e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-30
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-27
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-26
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-24
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-23
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-12
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-29
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-28
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-26
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-22
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-22
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-21
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 8e-16
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-28
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-25
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-24
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-23
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-22
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-21
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-19
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-27
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-23
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-23
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-16
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-12
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-27
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-25
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-23
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-22
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-19
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-17
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-12
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-26
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-25
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-23
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-20
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-19
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-17
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-16
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-14
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 7e-26
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-25
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-23
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-21
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-15
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-12
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-12
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-25
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-25
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-23
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-20
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-19
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-17
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 9e-17
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-12
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-23
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-19
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-18
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-16
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-14
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 8e-13
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-12
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-12
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-22
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-22
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-19
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-19
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-17
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-14
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-14
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-11
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-11
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-21
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 8e-20
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-19
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-18
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-15
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-14
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-12
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-12
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-20
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-19
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-17
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-14
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-05
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-20
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-16
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-16
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 8e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-12
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-08
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-08
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-08
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 7e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-19
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-12
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-12
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-19
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 8e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-15
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-15
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-12
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-19
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-17
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-15
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-15
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-10
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-19
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-16
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-13
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-11
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-19
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-16
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-13
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 9e-13
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-18
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-14
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-14
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-12
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-12
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-11
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-13
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-12
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-12
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-15
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-14
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-13
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-14
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-13
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-11
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-14
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-09
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 9e-12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 9e-11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-14
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-14
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-14
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-10
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-13
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-11
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-10
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-13
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-08
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-13
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-13
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-13
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-13
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-13
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-13
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-13
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-13
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 7e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-13
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-13
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-13
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-13
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-13
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-13
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-13
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 9e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-13
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-13
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-13
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-13
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-13
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-13
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-13
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-13
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-13
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 8e-13
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 9e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-13
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-13
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-13
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-13
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-13
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-12
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-12
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-12
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 7e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 6e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 7e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-12
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-12
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-12
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 7e-08
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-12
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-12
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-12
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-12
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-12
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-12
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-12
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-12
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 6e-12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 8e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 6e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 7e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-12
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 8e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-12
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-11
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-08
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 7e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 8e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 6e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 5e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 5e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 8e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-11
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 4e-11
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 8e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 8e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-11
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 9e-11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 9e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-09
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 7e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 9e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-10
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-09
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-09
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 7e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 7e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 7e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 5e-08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 9e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 5e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 5e-08
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 6e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 5e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 5e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 8e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 4e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 9e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  154 bits (391), Expect = 5e-44
 Identities = 66/184 (35%), Positives = 96/184 (52%), Gaps = 1/184 (0%)

Query: 378 KKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSF 437
             + +    +  G  P+ C  C KSF++   L +H   HTG   ++C  CGK F  +K  
Sbjct: 6   SSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDL 65

Query: 438 YIHKMVHSGEKPIKCSACGLAVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSELNAH 497
             H+  H+GEKP KC  CG +    ++L+ H R HTGEKPY C  CGK   +  + L AH
Sbjct: 66  TRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQL-AHLRAH 124

Query: 498 IQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIH 557
            +TH+  +P+ C  CG+ +  +  L  H   H+G  P+ C  C KSF+++  L  H   H
Sbjct: 125 QRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTH 184

Query: 558 NGTK 561
            G K
Sbjct: 185 TGKK 188


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query566
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 100.0
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.97
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.96
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.94
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.94
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.94
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.93
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.93
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.93
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.93
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.93
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.92
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.85
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.85
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.84
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.84
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.84
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.83
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.83
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.83
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.82
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.82
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.82
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.82
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.81
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.8
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.8
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.78
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.78
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.77
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.75
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.75
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.74
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.74
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.73
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.73
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.7
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.7
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.69
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.69
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.68
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.68
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.68
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.68
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.66
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.66
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.66
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.65
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.65
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.65
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.64
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.64
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.64
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.64
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.64
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.62
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.61
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.6
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.6
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.6
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.59
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.59
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.59
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.58
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.57
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.57
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.57
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.55
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.53
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.52
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.52
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.5
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.48
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.46
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.46
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.44
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.44
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.42
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.41
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.37
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.37
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.37
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.37
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.37
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.36
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.36
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.36
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.36
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.36
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.35
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.35
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.35
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.35
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.35
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.34
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.34
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.34
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.34
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.34
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.34
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.33
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.33
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.33
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.33
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.33
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.32
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.32
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.32
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.32
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.32
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.32
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.32
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.32
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.31
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.31
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.31
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.3
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.3
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.29
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.29
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.29
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.29
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.29
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.29
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.29
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.28
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.28
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.28
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.27
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.27
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.27
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.26
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.26
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.26
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.26
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.24
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.24
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.23
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.23
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.23
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.23
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.23
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.23
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.22
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.22
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.22
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.22
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.22
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.22
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.21
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.19
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.19
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.18
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.18
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.18
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.17
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.17
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.16
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.16
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.16
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.15
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.14
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.13
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.13
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.12
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.11
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.1
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.08
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.06
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.0
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.0
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.99
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.99
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.98
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.92
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.91
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.9
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.87
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.85
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.83
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.83
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.82
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.82
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.8
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.77
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.77
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.76
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.76
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.73
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.7
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.69
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.67
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.67
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.64
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.63
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.62
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.62
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.6
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.55
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.54
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.51
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.5
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.49
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.48
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.45
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.45
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.45
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.45
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.43
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.43
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.43
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.8
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.79
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.41
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.39
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.38
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.38
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.38
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.36
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.36
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.35
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.33
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.31
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.31
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.3
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.3
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.62
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.29
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.59
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.26
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.26
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.25
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.56
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.23
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.21
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.4
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.06
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.86
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.59
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.36
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.35
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.07
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.71
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.7
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.45
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.07
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.48
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.33
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 91.71
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 91.5
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 90.84
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 87.18
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 86.45
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 86.35
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 86.18
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 84.75
2k5c_A95 Uncharacterized protein PF0385; structural genomic 83.86
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 80.8
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 80.75
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 80.56
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=9.8e-44  Score=316.38  Aligned_cols=185  Identities=36%  Similarity=0.762  Sum_probs=147.2

Q ss_pred             hHHHHHHHhhhcCCCCccccccccccCChhhhhcccccccCCCccccCcccccccChhhHHHHHhhccCCCCccCCcCCc
Q psy18241        378 KKALLVHVGMHNGINPFTCSFCNKSFTQKVGLQKHLPIHTGSTRFQCDLCGKRFIHQKSFYIHKMVHSGEKPIKCSACGL  457 (566)
Q Consensus       378 ~~~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~l~~H~~~H~~~~~~~C~~C~~  457 (566)
                      ...|..|++.|.++++|.|++|++.|.+...|..|+++|+++++|+|++|++.|.....|..|+++|.++++|.|++|++
T Consensus         6 ~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   85 (190)
T 2i13_A            6 SSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGK   85 (190)
T ss_dssp             -------------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCC
T ss_pred             hccchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCC
Confidence            45688899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCChHHHHhHhhhhcCCCcccCcccccccccCHHHHHHHHhhcCCCCCccCCCCCCcccCchhHHhHhhhccCCCcccC
Q psy18241        458 AVLSSSHLKRHFRVHTGEKPYQCTTCGKRLRRTVSELNAHIQTHSDLRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTC  537 (566)
Q Consensus       458 ~f~~~~~l~~H~~~H~~~~~~~C~~C~k~f~~~~~~l~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C  537 (566)
                      .|.+...|..|+++|+++++|.|++|++.|... +.|..|+++|++++||+|++||+.|.++..|..|+++|++++||.|
T Consensus        86 ~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~-~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C  164 (190)
T 2i13_A           86 SFSQRANLRAHQRTHTGEKPYACPECGKSFSQL-AHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKC  164 (190)
T ss_dssp             EESCHHHHHHHHHHHHTCCCEECTTTCCEESSH-HHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEEC
T ss_pred             ccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCH-HHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeEC
Confidence            999999999999999999999999999999765 8899999999999999999999999999999999999999999999


Q ss_pred             CcChhhccChhhHHHHHhhhcCCCCC
Q psy18241        538 HFCNKSFTQKIGLVKHLNIHNGTKKY  563 (566)
Q Consensus       538 ~~C~~~f~~~~~L~~H~~~h~~~~~~  563 (566)
                      ++||+.|.++..|..|+++|+|++||
T Consensus       165 ~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          165 PECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             TTTCCEESSHHHHHHHHTTC------
T ss_pred             CCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            99999999999999999999999987



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 566
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 8e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 9e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 8e-08
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 8e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.002
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.002
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 7e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 6e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 5e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 5e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.001
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.001
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.004
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 4e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 4e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 4e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 5e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 5e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 5e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.001
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.001
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.001
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-04
d2epra135 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [ 3e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.001
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.003
d1ubdc228 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger 0.004
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.004
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 48.8 bits (117), Expect = 1e-08
 Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 445 SGEKPIKCSACGLAVLSSSHLKRHFR-VHTGEKPYQC 480
           S  KP  C +CG       HL  H + VHT E+P++C
Sbjct: 1   SVGKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKC 37


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query566
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.74
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.68
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.48
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.45
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.39
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.36
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.36
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.34
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.32
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.29
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.28
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.28
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.26
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.25
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.25
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.22
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.21
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.19
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.14
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.14
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.11
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.11
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.09
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.09
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.04
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.02
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 99.0
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.98
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.92
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.89
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.89
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.88
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.78
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.77
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.66
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.66
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.66
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.64
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.59
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.58
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.55
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.37
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.32
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.31
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.31
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.27
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.21
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.18
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.14
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.13
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.12
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.08
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.06
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.05
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.01
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.01
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.72
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.71
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.71
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.69
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.59
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.58
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.53
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.48
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.47
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.4
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.36
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.33
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.32
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.32
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.32
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.29
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.27
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.25
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.24
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.23
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.21
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.85
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.79
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.78
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.54
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.51
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.46
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.45
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.42
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.39
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.28
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.15
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.12
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.89
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.48
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.33
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.29
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.23
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.97
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.86
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.23
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 93.47
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.23
d1y0jb136 U-shaped transcription factor, different fingers { 92.38
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 92.12
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 92.07
d1y0jb136 U-shaped transcription factor, different fingers { 91.95
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 91.93
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.91
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.5
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 90.8
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.67
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 90.05
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.42
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 88.07
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 87.82
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 87.73
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 87.27
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 87.1
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 87.0
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 86.97
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 86.67
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 85.43
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 84.11
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 81.59
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 80.65
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.74  E-value=3.5e-19  Score=117.22  Aligned_cols=53  Identities=36%  Similarity=0.795  Sum_probs=49.1

Q ss_pred             CCCccCCCCCCcccCchhHHhHhhhccCCCcccCCcChhhccChhhHHHHHhhh
Q psy18241        504 LRPFVCEICGQGYKMKKALLVHVGMHSGIHPFTCHFCNKSFTQKIGLVKHLNIH  557 (566)
Q Consensus       504 ~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~h  557 (566)
                      ||||+|+ ||++|..+.+|..|+++|+|++||+|++||++|.+++.|.+||++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            6899995 9999999999999999999999999999999999999999999987



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure