Diaphorina citri psyllid: psy1834

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-

MMMTTAILIPIGKESSTMGHHGFGNLGPHIRNIVYHRISMFEQRAFAGLLNPGLQNTLRRITESAPRTVPYFLITYVIITQTNDYYAQLNRKNPKDYEHEV

ccccccEEEEcccccccccccccccccccccEEEEEEcccccHHHHHccHHHHHHHHHHHHHccccEEcHHHHHHHHHHHHHHHHHHHHcccccccccccc

*****AILIPIGKESSTMGHHGFGNLGPHIRNIVYHRISMFEQRAFAGLLNPGLQNTLRRITESAPRTVPYFLITYVIITQTNDYYAQLNRKN********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MMMTTAILIPIGKESSTMGHHGFGNLGPHIRNIVYHRISMFEQRAFAGLLNPGLQNTLRRITESAPRTVPYFLITYVIITQTNDYYAQLNRKNPKDYEHEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cytochrome b-c1 complex subunit 8	This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.	confident	O14949
Cytochrome b-c1 complex subunit 8	This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.	confident	Q9CQ69
Cytochrome b-c1 complex subunit 8	This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit, together with cytochrome b, binds to ubiquinone.	confident	Q7TQ16

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005743 [CC]	mitochondrial inner membrane	probable	GO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0044281 [BP]	small molecule metabolic process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0021854 [BP]	hypothalamus development	probable	GO:0032502, GO:0021536, GO:0032501, GO:0007420, GO:0044707, GO:0048856, GO:0007399, GO:0044767, GO:0048513, GO:0030900, GO:0008150, GO:0021761, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0022904 [BP]	respiratory electron transport chain	probable	GO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0022900, GO:0045333, GO:0008152, GO:0008150, GO:0006091, GO:0055114
GO:0021680 [BP]	cerebellar Purkinje cell layer development	probable	GO:0032502, GO:0044707, GO:0021549, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0022037, GO:0044767, GO:0048513, GO:0008150, GO:0030902, GO:0048731, GO:0021695, GO:0007275, GO:0044699, GO:0007417
GO:0021539 [BP]	subthalamus development	probable	GO:0032502, GO:0021536, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0030900, GO:0048731, GO:0008150, GO:0007275, GO:0044699, GO:0007417
GO:0021548 [BP]	pons development	probable	GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0022037, GO:0044767, GO:0048513, GO:0008150, GO:0030902, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0021766 [BP]	hippocampus development	probable	GO:0032502, GO:0021537, GO:0032501, GO:0007420, GO:0044707, GO:0048856, GO:0007399, GO:0044767, GO:0021543, GO:0048513, GO:0030900, GO:0008150, GO:0021761, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0021794 [BP]	thalamus development	probable	GO:0032502, GO:0021536, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0030900, GO:0048731, GO:0008150, GO:0007275, GO:0044699, GO:0007417
GO:0070469 [CC]	respiratory chain	probable	GO:0005575, GO:0044425, GO:0016020
GO:0008121 [MF]	ubiquinol-cytochrome-c reductase activity	probable	GO:0022891, GO:0022890, GO:0022892, GO:0005215, GO:0008324, GO:0022857, GO:0015075, GO:0003824, GO:0015077, GO:0003674, GO:0016679, GO:0015078, GO:0016681, GO:0016491
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0030901 [BP]	midbrain development	probable	GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0021860 [BP]	pyramidal neuron development	probable	GO:0032502, GO:0044707, GO:0030154, GO:0048468, GO:0021884, GO:0007275, GO:0044699, GO:0007417, GO:0048869, GO:0008150, GO:0048513, GO:0021879, GO:0021954, GO:0021872, GO:0021953, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0021859, GO:0022008, GO:0048699, GO:0007420, GO:0007399, GO:0048856, GO:0030900, GO:0048731

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PP9, chain G
Confidence level:very confident
Coverage over the Query: 19-95
View the alignment between query and template
View the model in PyMOL