Diaphorina citri psyllid: psy1836


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
MCLMLHASLVSLVGSASAFQAVQHDNTLYISGVLGIDASSGKMAEGVENQAKQALTNMGHILKEAGGSYEHVVKTTILLNDINDFATVNNVYGQFFKPPYPARSTFQVGKLPLIDFCLVVLGGHETL
ccEEccccccccccccccHHHHHHccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccHHHHHHHHHHccccccccHHHHHccccccEEEEEEEEcccccc
MCLMLHASLVSLVGSASAFQAVQHDNTLYISGVLGIDASSGKMAEGVENQAKQALTNMGHILKEAGGSYEHVVKTTILLNDINDFATVNNVYGQFFKPPYPARSTFQVGKLPLIDFCLVVLGGHE**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCLMLHASLVSLVGSASAFQAVQHDNTLYISGVLGIDASSGKMAEGVENQAKQALTNMGHILKEAGGSYEHVVKTTILLNDINDFATVNNVYGQFFKPPYPARSTFQVGKLPLIDFCLVVLGGHETL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RutC family protein C23G10.2 confidentQ10121
Ribonuclease UK114 Endoribonuclease responsible for the inhibition of the translation by cleaving mRNA. Inhibits cell-free protein synthesis. Cleaves phosphodiester bonds only in single-stranded RNA.confidentP52759
Ribonuclease UK114 Endoribonuclease responsible for the inhibition of the translation by cleaving mRNA. Inhibits cell-free protein synthesis. Cleaves phosphodiester bonds only in single-stranded RNA.confidentP52758

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organelleconfidentGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0019239 [MF]deaminase activityprobableGO:0003824, GO:0003674
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016020 [CC]membraneprobableGO:0005575
GO:0006449 [BP]regulation of translational terminationprobableGO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0051128, GO:0050789, GO:0010556, GO:0065007, GO:0008150, GO:0031326, GO:0006417, GO:0043244, GO:0050794, GO:0010468
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004519 [MF]endonuclease activityprobableGO:0004518, GO:0016787, GO:0003674, GO:0016788, GO:0003824
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0009579 [CC]thylakoidprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0009941 [CC]chloroplast envelopeprobableGO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0034641 [BP]cellular nitrogen compound metabolic processprobableGO:0009987, GO:0006807, GO:0008150, GO:0008152, GO:0044237
GO:0009097 [BP]isoleucine biosynthetic processprobableGO:0019752, GO:0044249, GO:0006807, GO:0044281, GO:0044283, GO:1901576, GO:0044710, GO:0044711, GO:0006549, GO:0006520, GO:0071704, GO:1901605, GO:1901607, GO:0044238, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0043436, GO:0008652, GO:1901564, GO:1901566, GO:0006082, GO:0046394, GO:0016053, GO:0044237, GO:0009081, GO:0009082
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005758 [CC]mitochondrial intermembrane spaceprobableGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429
GO:0006566 [BP]threonine metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:0044237, GO:0006520, GO:0019752, GO:0071704, GO:0006807, GO:0008150, GO:0009066, GO:0008152, GO:0043436, GO:1901605, GO:0044281

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QAH, chain A
Confidence level:very confident
Coverage over the Query: 12-123
View the alignment between query and template
View the model in PyMOL