Psyllid ID: psy1836

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
MCLMLHASLVSLVGSASAFQAVQHDNTLYISGVLGIDASSGKMAEGVENQAKQALTNMGHILKEAGGSYEHVVKTTILLNDINDFATVNNVYGQFFKPPYPARSTFQVGKLPLIDFCLVVLGGHETL
ccEEcccccccccccccHHHHHHHccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEcccccHHHHHHHHHHHcccccccHHHHHHcccccEEEEEEEEcccccc
ccEEEcccccccccccccccEEEEccEEEEEEEccEcccccEccccHHHHHHHHHHHHHHHHHHccccHHHEEEEEEEEccHHHHHHHHHHHcccccccccEEEEEEccEcHHEEEEEEEEEccccc
MCLMLHASLVSLVGsasafqavqhdntLYISGVLgidassgkmaeGVENQAKQALTNMGHILKEAGGSYEHVVKTTILLNdindfatvnnvygqffkppyparstfqvgklpliDFCLVVLGGHETL
MCLMLHASLVSLVGSASAFQAVQHDNTLYISGVLGIDASSGKMAEGVENQAKQALTNMGHILKEAGGSYEHVVKTTILLNDINDFATVNNVYGQFFKPPYPARSTFQVGKLPLIDFCLVVLGGHETL
MCLMLHaslvslvgsasaFQAVQHDNTLYISGVLGIDASSGKMAEGVENQAKQALTNMGHILKEAGGSYEHVVKTTILLNDINDFATVNNVYGQFFKPPYPARSTFQVGKLPLIDFCLVVLGGHETL
**LMLHASLVSLVGSASAFQAVQHDNTLYISGVLGIDA***************ALTNMGHILKEAGGSYEHVVKTTILLNDINDFATVNNVYGQFFKPPYPARSTFQVGKLPLIDFCLVVLGG****
MCLMLHASLVSLVGSASAFQAVQHDNTLYISGVLGIDASSGKMAEGVENQAKQALTNMGHILKEAGGSYEHVVKTTILLNDINDFATVNNVYGQFFKPPYPARSTFQVGKLPLIDFCLVVLGGHE**
MCLMLHASLVSLVGSASAFQAVQHDNTLYISGVLGIDASSGKMAEGVENQAKQALTNMGHILKEAGGSYEHVVKTTILLNDINDFATVNNVYGQFFKPPYPARSTFQVGKLPLIDFCLVVLGGHETL
*CLMLHASLVSLVGSASAFQAVQHDNTLYISGVLGIDASSGKMAEGVENQAKQALTNMGHILKEAGGSYEHVVKTTILLNDINDFATVNNVYGQFFKPPYPARSTFQVGKLPLIDFCLVVLGG****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCLMLHASLVSLVGSASAFQAVQHDNTLYISGVLGIDASSGKMAEGVENQAKQALTNMGHILKEAGGSYEHVVKTTILLNDINDFATVNNVYGQFFKPPYPARSTFQVGKLPLIDFCLVVLGGHETL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query127 2.2.26 [Sep-21-2011]
Q10121171 RutC family protein C23G1 yes N/A 0.826 0.614 0.518 6e-27
P52758137 Ribonuclease UK114 OS=Hom yes N/A 0.732 0.678 0.585 4e-25
Q3T114137 Ribonuclease UK114 OS=Bos yes N/A 0.732 0.678 0.574 6e-25
P80601137 Ribonuclease UK114 OS=Cap N/A N/A 0.732 0.678 0.563 3e-24
P52760135 Ribonuclease UK114 OS=Mus yes N/A 0.732 0.688 0.553 3e-23
P52759137 Ribonuclease UK114 OS=Rat yes N/A 0.732 0.678 0.542 1e-22
Q9ZKQ6125 RutC family protein jhp_0 yes N/A 0.866 0.88 0.464 5e-22
O25598125 RutC family protein HP_09 yes N/A 0.866 0.88 0.456 3e-21
P52761130 RutC family protein slr07 N/A N/A 0.803 0.784 0.467 1e-18
P55654126 RutC family protein y4sK no N/A 0.724 0.730 0.452 3e-16
>sp|Q10121|YSD2_CAEEL RutC family protein C23G10.2 OS=Caenorhabditis elegans GN=C23G10.2 PE=3 SV=3 Back     alignment and function desciption
 Score =  119 bits (298), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 56/108 (51%), Positives = 74/108 (68%), Gaps = 3/108 (2%)

Query: 20  QAVQHDNTLYISGVLGIDASSGKMAEGVENQAKQALTNMGHILKEAGGSYEHVVKTTILL 79
           QAV+  NT+Y+SG LG+D  +G + EGV  Q  Q+L N+G +LK AG  Y +VVKTT+LL
Sbjct: 58  QAVRAGNTIYLSGSLGLDPKTGDLKEGVVEQTHQSLKNLGEVLKAAGADYGNVVKTTVLL 117

Query: 80  NDINDFATVNNVYGQFFKPPYPARSTFQVGKLP---LIDFCLVVLGGH 124
            +I DFA VN VYGQ+FK PYPAR+ +QV  LP   L++   V + G 
Sbjct: 118 QNIADFAAVNEVYGQYFKSPYPARAAYQVAALPKGGLVEIEAVAIAGE 165

Caenorhabditis elegans (taxid: 6239)
>sp|P52758|UK114_HUMAN Ribonuclease UK114 OS=Homo sapiens GN=HRSP12 PE=1 SV=1 Back     alignment and function description
>sp|Q3T114|UK114_BOVIN Ribonuclease UK114 OS=Bos taurus GN=HRSP12 PE=2 SV=3 Back     alignment and function description
>sp|P80601|UK114_CAPHI Ribonuclease UK114 OS=Capra hircus GN=HRSP12 PE=1 SV=3 Back     alignment and function description
>sp|P52760|UK114_MOUSE Ribonuclease UK114 OS=Mus musculus GN=Hrsp12 PE=1 SV=3 Back     alignment and function description
>sp|P52759|UK114_RAT Ribonuclease UK114 OS=Rattus norvegicus GN=Hrsp12 PE=1 SV=3 Back     alignment and function description
>sp|Q9ZKQ6|Y944_HELPJ RutC family protein jhp_0879 OS=Helicobacter pylori (strain J99) GN=jhp_0879 PE=3 SV=1 Back     alignment and function description
>sp|O25598|Y944_HELPY RutC family protein HP_0944 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0944 PE=3 SV=1 Back     alignment and function description
>sp|P52761|Y709_SYNY3 RutC family protein slr0709 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0709 PE=3 SV=1 Back     alignment and function description
>sp|P55654|Y4SK_RHISN RutC family protein y4sK OS=Rhizobium sp. (strain NGR234) GN=NGR_a01620 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query127
350410295137 PREDICTED: ribonuclease UK114-like isofo 0.740 0.686 0.652 2e-27
383848293139 PREDICTED: ribonuclease UK114-like isofo 0.740 0.676 0.642 4e-27
340719840137 PREDICTED: ribonuclease UK114-like [Bomb 0.740 0.686 0.652 4e-27
268569100172 Hypothetical protein CBG24261 [Caenorhab 0.826 0.610 0.537 5e-27
308498616171 hypothetical protein CRE_02928 [Caenorha 0.976 0.725 0.465 1e-26
380023830137 PREDICTED: ribonuclease UK114-like [Apis 0.740 0.686 0.610 8e-26
341895039168 hypothetical protein CAEBREN_22515 [Caen 0.826 0.625 0.518 8e-26
328793595137 PREDICTED: ribonuclease UK114-like isofo 0.740 0.686 0.610 1e-25
71982068171 Protein C23G10.2, isoform a [Caenorhabdi 0.826 0.614 0.518 4e-25
308322413136 ribonuclease uk114 [Ictalurus furcatus] 0.732 0.683 0.627 5e-25
>gi|350410295|ref|XP_003489005.1| PREDICTED: ribonuclease UK114-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 75/95 (78%), Gaps = 1/95 (1%)

Query: 20  QAVQHDNTLYISGVLGIDASSGKM-AEGVENQAKQALTNMGHILKEAGGSYEHVVKTTIL 78
           QAV  D+TLY+SG LG+D  +GK+ A G   +A+QAL NMGHILKEAG +Y+ VVKTTI 
Sbjct: 25  QAVLVDHTLYLSGSLGVDVKTGKLVAGGAAVEARQALINMGHILKEAGSNYDKVVKTTIF 84

Query: 79  LNDINDFATVNNVYGQFFKPPYPARSTFQVGKLPL 113
           L DIN+F+ VN VY +FFK  YPARSTFQVGKLP+
Sbjct: 85  LQDINEFSDVNEVYKEFFKENYPARSTFQVGKLPM 119

Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383848293|ref|XP_003699786.1| PREDICTED: ribonuclease UK114-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|340719840|ref|XP_003398353.1| PREDICTED: ribonuclease UK114-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|268569100|ref|XP_002648175.1| Hypothetical protein CBG24261 [Caenorhabditis briggsae] Back     alignment and taxonomy information
>gi|308498616|ref|XP_003111494.1| hypothetical protein CRE_02928 [Caenorhabditis remanei] gi|308239403|gb|EFO83355.1| hypothetical protein CRE_02928 [Caenorhabditis remanei] Back     alignment and taxonomy information
>gi|380023830|ref|XP_003695714.1| PREDICTED: ribonuclease UK114-like [Apis florea] Back     alignment and taxonomy information
>gi|341895039|gb|EGT50974.1| hypothetical protein CAEBREN_22515 [Caenorhabditis brenneri] Back     alignment and taxonomy information
>gi|328793595|ref|XP_003251902.1| PREDICTED: ribonuclease UK114-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|71982068|ref|NP_741177.2| Protein C23G10.2, isoform a [Caenorhabditis elegans] gi|67477404|sp|Q10121.3|YSD2_CAEEL RecName: Full=RutC family protein C23G10.2 gi|351050699|emb|CCD65294.1| Protein C23G10.2, isoform a [Caenorhabditis elegans] Back     alignment and taxonomy information
>gi|308322413|gb|ADO28344.1| ribonuclease uk114 [Ictalurus furcatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query127
ZFIN|ZDB-GENE-040718-315135 hrsp12 "heat-responsive protei 0.811 0.762 0.560 5.9e-25
UNIPROTKB|H0YB34148 HRSP12 "Ribonuclease UK114" [H 0.732 0.628 0.585 1.1e-23
UNIPROTKB|P52758137 HRSP12 "Ribonuclease UK114" [H 0.732 0.678 0.585 1.1e-23
UNIPROTKB|F1S0M2137 HRSP12 "Uncharacterized protei 0.732 0.678 0.574 1.1e-23
UNIPROTKB|Q3T114137 HRSP12 "Ribonuclease UK114" [B 0.732 0.678 0.574 2.3e-23
MGI|MGI:1095401135 Hrsp12 "heat-responsive protei 0.732 0.688 0.553 2.1e-22
TAIR|locus:2092374187 AT3G20390 "AT3G20390" [Arabido 0.740 0.502 0.526 3.4e-22
RGD|70940137 Hrsp12 "heat-responsive protei 0.732 0.678 0.542 9e-22
UNIPROTKB|E1C7E1132 HRSP12 "Uncharacterized protei 0.732 0.704 0.510 8e-21
FB|FBgn0086691138 UK114 "UK114" [Drosophila mela 0.842 0.775 0.437 5.1e-19
ZFIN|ZDB-GENE-040718-315 hrsp12 "heat-responsive protein 12" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 284 (105.0 bits), Expect = 5.9e-25, P = 5.9e-25
 Identities = 60/107 (56%), Positives = 78/107 (72%)

Query:    20 QAVQHDNTLYISGVLGIDASSGKMAEGVENQAKQALTNMGHILKEAGGSYEHVVKTTILL 79
             QAV  D T+YISG LG+D +SG++A GV+ Q KQAL N+G ILK AG  YE+VVK T+L+
Sbjct:    23 QAVLVDRTMYISGQLGMDPASGQLAAGVQAQTKQALINIGEILKAAGCGYENVVKATVLM 82

Query:    80 NDINDFATVNNVYGQFFKPPYPARSTFQVGKLP---LIDF-CLVVLG 122
              DIN+F TVN+VY QFFK  +PAR+ +QV  LP   L++   + VLG
Sbjct:    83 TDINEFNTVNDVYKQFFKSNFPARAAYQVVALPRGGLVEIEAVAVLG 129
GO:0003674 "molecular_function" evidence=ND
GO:0008150 "biological_process" evidence=ND
UNIPROTKB|H0YB34 HRSP12 "Ribonuclease UK114" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P52758 HRSP12 "Ribonuclease UK114" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S0M2 HRSP12 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T114 HRSP12 "Ribonuclease UK114" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1095401 Hrsp12 "heat-responsive protein 12" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
TAIR|locus:2092374 AT3G20390 "AT3G20390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|70940 Hrsp12 "heat-responsive protein 12" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C7E1 HRSP12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0086691 UK114 "UK114" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O52178DFRA_MYXXANo assigned EC number0.41660.73220.7099yesN/A
Q8U308RIDA_PYRFU3, ., 5, ., 4, ., -0.41480.73220.7380yesN/A
P40037HMF1_YEASTNo assigned EC number0.36660.69290.6821yesN/A
Q97U19Y3206_SULSONo assigned EC number0.31730.78740.7936yesN/A
B8H1Q2RUTC_CAUCN1, ., -, ., -, ., -0.33720.66920.6589yesN/A
B1ZB17RUTC_METPB1, ., -, ., -, ., -0.34880.66920.6538yesN/A
Q10121YSD2_CAEELNo assigned EC number0.51850.82670.6140yesN/A
C5B0U7RUTC_METEA1, ., -, ., -, ., -0.33720.66920.6538yesN/A
P52759UK114_RAT3, ., 1, ., -, ., -0.54250.73220.6788yesN/A
P52758UK114_HUMAN3, ., 1, ., -, ., -0.58510.73220.6788yesN/A
Q89AG0Y334_BUCBPNo assigned EC number0.33330.70860.7142yesN/A
D5VGV2RUTC_CAUST1, ., -, ., -, ., -0.34880.66920.6589yesN/A
O66689Y364_AQUAENo assigned EC number0.42700.74010.752yesN/A
P40431YVN1_AZOVINo assigned EC number0.35100.73220.7322yesN/A
O34133ALDR_LACLANo assigned EC number0.38370.66920.6746yesN/A
Q9L6B5Y1466_PASMUNo assigned EC number0.40200.73220.7209yesN/A
P44839Y719_HAEINNo assigned EC number0.39170.73220.7153yesN/A
P37552RIDA_BACSU3, ., 5, ., 4, ., -0.42690.68500.696yesN/A
Q7CP78RIDA_SALTY3, ., 5, ., 4, ., -0.40620.73220.7265yesN/A
P57452Y371_BUCAINo assigned EC number0.34370.73220.7265yesN/A
Q973T6Y811_SULTONo assigned EC number0.37030.81880.832yesN/A
O25598Y944_HELPYNo assigned EC number0.45610.86610.88yesN/A
Q9UZA3Y1251_PYRABNo assigned EC number0.39360.73220.7322yesN/A
Q8K9H7Y359_BUCAPNo assigned EC number0.31250.73220.7265yesN/A
Q9ZKQ6Y944_HELPJNo assigned EC number0.46490.86610.88yesN/A
Q9A4N4RUTC_CAUCR1, ., -, ., -, ., -0.33720.66920.6589yesN/A
Q3T114UK114_BOVIN3, ., 1, ., -, ., -0.57440.73220.6788yesN/A
P0AGL4TDCF_SHIFL3, ., 5, ., 4, ., -0.3750.73220.7209yesN/A
P0AGL3TDCF_ECOL63, ., 5, ., 4, ., -0.3750.73220.7209yesN/A
O58584Y854_PYRHONo assigned EC number0.40420.73220.7380yesN/A
P52760UK114_MOUSE3, ., 1, ., -, ., -0.55310.73220.6888yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
TIGR00004124 TIGR00004, TIGR00004, reactive intermediate/imine 1e-40
cd00448107 cd00448, YjgF_YER057c_UK114_family, YjgF, YER057c, 4e-35
pfam01042120 pfam01042, Ribonuc_L-PSP, Endoribonuclease L-PSP 3e-34
COG0251130 COG0251, TdcF, Putative translation initiation inh 3e-31
cd06154119 cd06154, YjgF_YER057c_UK114_like_6, This group of 1e-20
PRK11401129 PRK11401, PRK11401, putative endoribonuclease L-PS 6e-20
cd06155101 cd06155, eu_AANH_C_1, A group of hypothetical euka 3e-17
cd02198111 cd02198, YjgH_like, YjgH belongs to a large family 7e-17
cd06150105 cd06150, YjgF_YER057c_UK114_like_2, This group of 1e-15
TIGR03610126 TIGR03610, RutC, pyrimidine utilization protein C 1e-12
cd06151126 cd06151, YjgF_YER057c_UK114_like_3, This group of 4e-07
cd06152114 cd06152, YjgF_YER057c_UK114_like_4, YjgF, YER057c, 2e-05
>gnl|CDD|129116 TIGR00004, TIGR00004, reactive intermediate/imine deaminase Back     alignment and domain information 
 Score =  131 bits (331), Expect = 1e-40
 Identities = 49/95 (51%), Positives = 65/95 (68%), Gaps = 1/95 (1%)

Query: 20  QAVQHDNTLYISGVLGIDASSGKMAEG-VENQAKQALTNMGHILKEAGGSYEHVVKTTIL 78
           QAV+  NT+Y+SG + +D S+G++  G +  QA+Q L N+  IL+ AG S + VVKTT+ 
Sbjct: 18  QAVKVGNTVYVSGQIPLDPSTGELVGGDIAEQAEQVLENLKAILEAAGLSLDDVVKTTVF 77

Query: 79  LNDINDFATVNNVYGQFFKPPYPARSTFQVGKLPL 113
           L D+NDFA VN VYGQ+F   YPARS  QV  LP 
Sbjct: 78  LTDLNDFAEVNEVYGQYFDEHYPARSAVQVAALPK 112

This protein was described initially as an inhibitor of protein synthesis intiation, then as an endoribonuclease active on single-stranded mRNA, endoribonuclease L-PSP. Members of this family, conserved in all domains of life and often with several members per bacterial genome, appear to catalyze a reaction that minimizes toxic by-products from reactions catalyzed by pyridoxal phosphate-dependent enzymes [Cellular processes, Other]. Length = 124
>gnl|CDD|100004 cd00448, YjgF_YER057c_UK114_family, YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>gnl|CDD|216262 pfam01042, Ribonuc_L-PSP, Endoribonuclease L-PSP Back     alignment and domain information
>gnl|CDD|223329 COG0251, TdcF, Putative translation initiation inhibitor, yjgF family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|100011 cd06154, YjgF_YER057c_UK114_like_6, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>gnl|CDD|105214 PRK11401, PRK11401, putative endoribonuclease L-PSP; Provisional Back     alignment and domain information
>gnl|CDD|100012 cd06155, eu_AANH_C_1, A group of hypothetical eukaryotic proteins, characterized by the presence of an adenine nucleotide alpha hydrolase (AANH)-like domain located N-terminal to two distinctly different YjgF-YER057c-UK114-like domains Back     alignment and domain information
>gnl|CDD|100005 cd02198, YjgH_like, YjgH belongs to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>gnl|CDD|100007 cd06150, YjgF_YER057c_UK114_like_2, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>gnl|CDD|211850 TIGR03610, RutC, pyrimidine utilization protein C Back     alignment and domain information
>gnl|CDD|100008 cd06151, YjgF_YER057c_UK114_like_3, This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>gnl|CDD|100009 cd06152, YjgF_YER057c_UK114_like_4, YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 127
cd06152114 YjgF_YER057c_UK114_like_4 YjgF, YER057c, and UK114 100.0
TIGR03610127 RutC pyrimidine utilization protein C. This protei 100.0
cd02198111 YjgH_like YjgH belongs to a large family of YjgF/Y 100.0
cd06154119 YjgF_YER057c_UK114_like_6 This group of proteins b 100.0
PRK11401129 putative endoribonuclease L-PSP; Provisional 100.0
COG0251130 TdcF Putative translation initiation inhibitor, yj 100.0
TIGR00004124 endoribonuclease L-PSP, putative. This protein was 100.0
PF01042121 Ribonuc_L-PSP: Endoribonuclease L-PSP; InterPro: I 100.0
cd06150105 YjgF_YER057c_UK114_like_2 This group of proteins b 100.0
cd06156118 eu_AANH_C_2 A group of hypothetical eukaryotic pro 100.0
cd02199142 YjgF_YER057c_UK114_like_1 This group of proteins b 100.0
cd06153114 YjgF_YER057c_UK114_like_5 This group of proteins b 100.0
cd06151126 YjgF_YER057c_UK114_like_3 This group of proteins b 99.98
cd00448107 YjgF_YER057c_UK114_family YjgF, YER057c, and UK114 99.97
cd06155101 eu_AANH_C_1 A group of hypothetical eukaryotic pro 99.97
KOG2317|consensus138 99.95
PF14588148 YjgF_endoribonc: YjgF/chorismate_mutase-like, puta 99.58
>cd06152 YjgF_YER057c_UK114_like_4 YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information 
Probab=100.00  E-value=1.5e-37  Score=209.51  Aligned_cols=107  Identities=27%  Similarity=0.335  Sum_probs=102.2

Q ss_pred             CCcceEEEECCEEEEccccccCCCCCcccccHHHHHHHHHHHHHHHHHHcC-CCccceEEEEEEeCCC---CCHHHHHHH
Q psy1836          16 ASAFQAVQHDNTLYISGVLGIDASSGKMAEGVENQAKQALTNMGHILKEAG-GSYEHVVKTTILLNDI---NDFATVNNV   91 (127)
Q Consensus        16 ~~ys~av~~g~~v~iSG~~~~d~~~g~~~~d~~~Q~~~~~~ni~~~L~~~G-~~~~~vv~~~vyl~d~---~~~~~~~~v   91 (127)
                      .+|||++++|+++|+|||+|.|++.+.+++|+++|++++|+||+++|+++| ++++||+|+|+|++|+   ++++.++++
T Consensus         1 ~~ys~av~~g~~v~~SGq~g~d~~g~~~~~d~~~Q~~~~~~Nl~~~L~~aG~~~~~dVvk~tvyltd~~~~~~~~~~~~~   80 (114)
T cd06152           1 LHYSQAVRIGDRIEISGQGGWDPDTGKIPEDLEEEIDQAFDNVELALKAAGGKGWEQVYKVNSYHVDIKNEEAFGLMVEN   80 (114)
T ss_pred             CCCCCeEEECCEEEEeccCCcCCCCCccCcCHHHHHHHHHHHHHHHHHHhCCCCHHHEEEEEEEEecCCcHHHHHHHHHH
Confidence            379999999999999999999995557779999999999999999999999 9999999999999999   799999999


Q ss_pred             HHhhcCCCCCccEEEEcCCCCCCCEEEEEec
Q psy1836          92 YGQFFKPPYPARSTFQVGKLPLIDFCLVVLG  122 (127)
Q Consensus        92 ~~~~f~~~~Pa~t~v~V~~L~~~~~liEi~~  122 (127)
                      |.+||++++|+||+++|++|+.|+++||||+
T Consensus        81 ~~~~f~~~~Pa~t~v~V~~L~~p~~lVEIe~  111 (114)
T cd06152          81 FKKWMPNHQPIWTCVGVTALGLPGMRVEIEV  111 (114)
T ss_pred             HHHHcCCCCCCeEEEEeccCCCCCcEEEEEE
Confidence            9999999999999999999999999999996

The conserved domain is similar in structure to chorismate mutase but there is no sequence similarity and no functional connection. Members of this family have been implicated in isoleucine (Yeo7, Ibm1, aldR) and purine (YjgF) biosynthesis, as well as threonine anaerobic degradation (tdcF) and mitochondrial DNA maintenance (Ibm1). This domain homotrimerizes forming a distinct intersubunit cavity that may serve as a small molecule binding site.
>TIGR03610 RutC pyrimidine utilization protein C Back     alignment and domain information
>cd02198 YjgH_like YjgH belongs to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>cd06154 YjgF_YER057c_UK114_like_6 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>PRK11401 putative endoribonuclease L-PSP; Provisional Back     alignment and domain information
>COG0251 TdcF Putative translation initiation inhibitor, yjgF family [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00004 endoribonuclease L-PSP, putative Back     alignment and domain information
>PF01042 Ribonuc_L-PSP: Endoribonuclease L-PSP; InterPro: IPR006175 This domain is found in endoribonuclease, that is active on single-stranded mRNA and inhibits protein synthesis by cleavage of mRNA [] Back     alignment and domain information
>cd06150 YjgF_YER057c_UK114_like_2 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>cd06156 eu_AANH_C_2 A group of hypothetical eukaryotic proteins, characterized by the presence of an adenine nucleotide alpha hydrolase (AANH)-like domain located N-terminal to two distinctly different YjgF-YER057c-UK114-like domains Back     alignment and domain information
>cd02199 YjgF_YER057c_UK114_like_1 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>cd06153 YjgF_YER057c_UK114_like_5 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>cd06151 YjgF_YER057c_UK114_like_3 This group of proteins belong to a large family of YjgF/YER057c/UK114-like proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>cd00448 YjgF_YER057c_UK114_family YjgF, YER057c, and UK114 belong to a large family of proteins present in bacteria, archaea, and eukaryotes with no definitive function Back     alignment and domain information
>cd06155 eu_AANH_C_1 A group of hypothetical eukaryotic proteins, characterized by the presence of an adenine nucleotide alpha hydrolase (AANH)-like domain located N-terminal to two distinctly different YjgF-YER057c-UK114-like domains Back     alignment and domain information
>KOG2317|consensus Back     alignment and domain information
>PF14588 YjgF_endoribonc: YjgF/chorismate_mutase-like, putative endoribonuclease; PDB: 2OTM_B 3D01_D Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
1oni_A138 Crystal Structure Of A Human P14.5, A Translational 6e-26
1nq3_A136 Crystal Structure Of The Mammalian Tumor Associated 4e-25
1qah_A136 Crystal Structure Of Perchloric Acid Soluble Protei 2e-23
1xrg_A156 Conserved Hypothetical Protein From Clostridium The 9e-19
3k0t_A143 Crystal Structure Of Pspto -Psp Protein In Complex 6e-18
2dyy_A126 Crystal Structure Of Putative Translation Initiatio 2e-16
3l7q_A125 Crystal Structure Of Aldr From Streptococcus Mutans 5e-16
1j7h_A130 Solution Structure Of Hi0719, A Hypothetical Protei 2e-15
1qd9_A124 Bacillus Subtilis Yabj Length = 124 4e-15
2cwj_A123 Crystal Structure Of Ape1501, A Putative Endonuclea 1e-14
3r0p_A127 Crystal Structure Of L-Psp Putative Endoribonucleas 1e-14
1x25_A128 Crystal Structure Of A Member Of Yjgf Family From S 2e-14
2uyj_A129 Crystal Structure Of E. Coli Tdcf With Bound Ethyle 2e-14
2uyn_A129 Crystal Structure Of E. Coli Tdcf With Bound 2-Keto 3e-14
3mqw_A148 Crystal Structure Of A Putative Endoribonuclease L- 8e-14
3m1x_A148 Crystal Structure Of A Putative Endoribonuclease L- 8e-14
3m4s_A148 Crystal Structure Of A Putative Endoribonuclease L- 9e-14
1qu9_A128 1.2 A Crystal Structure Of Yjgf Gene Product From E 1e-13
3vcz_A153 1.80 Angstrom Resolution Crystal Structure Of A Put 1e-13
2csl_A124 Crystal Structure Of Ttha0137 From Thermus Thermoph 2e-13
1jd1_A129 Crystal Structure Of Yeo7_yeast Length = 129 7e-12
2b33_A140 Crystal Structure Of A Putative Endoribonuclease (t 1e-11
3quw_A153 Crystal Structure Of Yeast Mmf1 Length = 153 3e-11
3v4d_A134 Crystal Structure Of Rutc Protein A Member Of The Y 6e-08
3k12_A122 Crystal Structure Of An Uncharacterized Protein A6v 2e-06
3gtz_A124 Crystal Structure Of A Putative Translation Initiat 3e-04
3lme_A138 Structure Of Probable Translation Initiation Inhibi 4e-04
>pdb|1ONI|A Chain A, Crystal Structure Of A Human P14.5, A Translational Inhibitor Reveals Different Mode Of Ligand Binding Near The Invariant Residues Of The Yjgf/uk114 Protein Family Length = 138 Back     alignment and structure 
Iteration: 1

 Score =  112 bits (280), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 55/94 (58%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
Query: 20  QAVQHDNTLYISGVLGIDASSGKMAEG-VENQAKQALTNMGHILKEAGGSYEHVVKTTIL 78
           QAV  D T+YISG +G+D SSG++  G V  +AKQAL NMG ILK AG  + +VVKTT+L
Sbjct: 24  QAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAAGCDFTNVVKTTVL 83
Query: 79  LNDINDFATVNNVYGQFFKPPYPARSTFQVGKLP 112
           L DINDF TVN +Y Q+FK  +PAR+ +QV  LP
Sbjct: 84  LADINDFNTVNEIYKQYFKSNFPARAAYQVAALP 117
>pdb|1NQ3|A Chain A, Crystal Structure Of The Mammalian Tumor Associated Antigen Uk114 Length = 136 Back     alignment and structure
>pdb|1QAH|A Chain A, Crystal Structure Of Perchloric Acid Soluble Protein-A Translational Inhibitor Length = 136 Back     alignment and structure
>pdb|1XRG|A Chain A, Conserved Hypothetical Protein From Clostridium Thermocellum Cth-2968 Length = 156 Back     alignment and structure
>pdb|3K0T|A Chain A, Crystal Structure Of Pspto -Psp Protein In Complex With D-Be From Pseudomonas Syringae Pv. Tomato Str. Dc3000 Length = 143 Back     alignment and structure
>pdb|2DYY|A Chain A, Crystal Structure Of Putative Translation Initiation Inhibitor Ph0854 From Pyrococcus Horikoshii Length = 126 Back     alignment and structure
>pdb|3L7Q|A Chain A, Crystal Structure Of Aldr From Streptococcus Mutans Length = 125 Back     alignment and structure
>pdb|1J7H|A Chain A, Solution Structure Of Hi0719, A Hypothetical Protein From Haemophilus Influenzae Length = 130 Back     alignment and structure
>pdb|1QD9|A Chain A, Bacillus Subtilis Yabj Length = 124 Back     alignment and structure
>pdb|2CWJ|A Chain A, Crystal Structure Of Ape1501, A Putative Endonuclease From Aeropyrum Pernix Length = 123 Back     alignment and structure
>pdb|3R0P|A Chain A, Crystal Structure Of L-Psp Putative Endoribonuclease From Uncultured Organism Length = 127 Back     alignment and structure
>pdb|1X25|A Chain A, Crystal Structure Of A Member Of Yjgf Family From Sulfolobus Tokodaii (st0811) Length = 128 Back     alignment and structure
>pdb|2UYJ|A Chain A, Crystal Structure Of E. Coli Tdcf With Bound Ethylene Glycol Length = 129 Back     alignment and structure
>pdb|2UYN|A Chain A, Crystal Structure Of E. Coli Tdcf With Bound 2-Ketobutyrate Length = 129 Back     alignment and structure
>pdb|3MQW|A Chain A, Crystal Structure Of A Putative Endoribonuclease L-Psp From Histolytica With Higher Solvent Content And An Ordered N-Te Length = 148 Back     alignment and structure
>pdb|3M1X|A Chain A, Crystal Structure Of A Putative Endoribonuclease L-Psp From Entamoeba Histolytica, Rhomobohedral Form Length = 148 Back     alignment and structure
>pdb|3M4S|A Chain A, Crystal Structure Of A Putative Endoribonuclease L-Psp From Entamoeba Histolytica, Orthorhombic Form Length = 148 Back     alignment and structure
>pdb|1QU9|A Chain A, 1.2 A Crystal Structure Of Yjgf Gene Product From E. Coli Length = 128 Back     alignment and structure
>pdb|3VCZ|A Chain A, 1.80 Angstrom Resolution Crystal Structure Of A Putative Translation Initiation Inhibitor From Vibrio Vulnificus Cmcp6 Length = 153 Back     alignment and structure
>pdb|2CSL|A Chain A, Crystal Structure Of Ttha0137 From Thermus Thermophilus Hb8 Length = 124 Back     alignment and structure
>pdb|1JD1|A Chain A, Crystal Structure Of Yeo7_yeast Length = 129 Back     alignment and structure
>pdb|2B33|A Chain A, Crystal Structure Of A Putative Endoribonuclease (tm0215) From Thermotoga Maritima Msb8 At 2.30 A Resolution Length = 140 Back     alignment and structure
>pdb|3QUW|A Chain A, Crystal Structure Of Yeast Mmf1 Length = 153 Back     alignment and structure
>pdb|3V4D|A Chain A, Crystal Structure Of Rutc Protein A Member Of The Yjgf Family From E.Coli Length = 134 Back     alignment and structure
>pdb|3K12|A Chain A, Crystal Structure Of An Uncharacterized Protein A6v7t0 From Pseudomonas Aeruginosa Length = 122 Back     alignment and structure
>pdb|3GTZ|A Chain A, Crystal Structure Of A Putative Translation Initiation Inhibitor From Salmonella Typhimurium Length = 124 Back     alignment and structure
>pdb|3LME|A Chain A, Structure Of Probable Translation Initiation Inhibitor From (Rpa2473) From Rhodopseudomonas Palustris Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
3k0t_A143 Endoribonuclease L-PSP, putative; glucose binding, 5e-48
1qah_A136 Perchloric acid soluble protein; alpha-beta struct 7e-48
3quw_A153 Protein MMF1; chorismate mutase fold, intact mitoc 4e-47
3v4d_A134 Aminoacrylate peracid reductase RUTC; structural g 1e-46
2dyy_A126 UPF0076 protein PH0854; putative translation initi 1e-46
2b33_A140 Protein synthesis inhibitor, putative; putative en 1e-46
2cwj_A123 Putative endonuclease; hydrolase, endoribonucrease 1e-46
3l7q_A125 Putative translation initiation inhibitor, ALDR R 2e-46
1qu9_A128 YJGF protein; structural genomics; HET: CSP; 1.20A 2e-46
1jd1_A129 Hypothetical 13.9 kDa protein in FCY2-PET117 inter 2e-46
1qd9_A124 Purine regulatory protein YABJ; perchloric acid so 2e-46
1x25_A128 Hypothetical UPF0076 protein ST0811; YJGF-like pro 3e-46
3r0p_A127 L-PSP putative endoribonuclease; hydrolase; 1.90A 3e-46
1xrg_A156 Putative translation initiation inhibitor, YJGF fa 4e-46
2cvl_A124 TTHA0137, protein translation initiation inhibitor 5e-46
3m1x_A148 Putative endoribonuclease L-PSP; structural genomi 9e-46
3vcz_A153 Endoribonuclease L-PSP; virulence, pathogenesis, i 2e-45
3lme_A138 Possible translation initiation inhibitor; structu 1e-43
3i3f_A141 Hypothetical protein; structural genomics, niaid, 4e-39
3lyb_A165 Putative endoribonuclease; structural genomics, PS 8e-39
1pf5_A131 Hypothetical protein YJGH; structural genomics, be 1e-38
3i7t_A149 RV2704, putative uncharacterized protein; siras, Y 4e-38
2ig8_A144 Hypothetical protein PA3499; structural genomics, 1e-37
2ewc_A126 Conserved hypothetical protein; YJGF proteins fami 4e-37
3k12_A122 Uncharacterized protein A6V7T0; structural genomic 2e-34
3kjj_A128 NMB1025 protein; YJGF protein family, OPPF, struct 8e-34
3gtz_A124 Putative translation initiation inhibitor; structu 4e-31
>3k0t_A Endoribonuclease L-PSP, putative; glucose binding, ER stressor, sugar binding protein; HET: BGC; 2.10A {Pseudomonas syringae PV} Length = 143 Back     alignment and structure
 Score =  150 bits (380), Expect = 5e-48
 Identities = 38/94 (40%), Positives = 58/94 (61%)

Query: 20  QAVQHDNTLYISGVLGIDASSGKMAEGVENQAKQALTNMGHILKEAGGSYEHVVKTTILL 79
           QA++  NT+Y+SG + +D S+ ++ EG+E Q  Q   N+  + + AGGS++ +VK  I L
Sbjct: 37  QAIKAGNTVYMSGQIPLDPSTMELVEGIEAQITQVFENLKSVAQAAGGSFKDIVKLNIFL 96

Query: 80  NDINDFATVNNVYGQFFKPPYPARSTFQVGKLPL 113
            D+  FA VN + G +F  PYPAR+   V  LP 
Sbjct: 97  TDLGHFAKVNEIMGSYFSQPYPARAAIGVAALPR 130
>1qah_A Perchloric acid soluble protein; alpha-beta structure; 1.80A {Rattus norvegicus} SCOP: d.79.1.1 PDB: 1oni_A 1nq3_A Length = 136 Back     alignment and structure
>3quw_A Protein MMF1; chorismate mutase fold, intact mitochondria maintenance, mitochondrial protein, protein binding; 1.75A {Saccharomyces cerevisiae} Length = 153 Back     alignment and structure
>3v4d_A Aminoacrylate peracid reductase RUTC; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 1.95A {Escherichia coli O6} Length = 134 Back     alignment and structure
>2dyy_A UPF0076 protein PH0854; putative translation initiation inhibitor, trimer, structural genomics, NPPSFA; 2.60A {Pyrococcus horikoshii} Length = 126 Back     alignment and structure
>2b33_A Protein synthesis inhibitor, putative; putative endoribonuclease, STRU genomics, joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: d.79.1.1 Length = 140 Back     alignment and structure
>2cwj_A Putative endonuclease; hydrolase, endoribonucrease, structural GE NPPSFA, national project on protein structural and function analyses; 3.60A {Aeropyrum pernix} SCOP: d.79.1.1 Length = 123 Back     alignment and structure
>3l7q_A Putative translation initiation inhibitor, ALDR R like protein; translation initiation inhibitor regulator-like; 2.50A {Streptococcus mutans} Length = 125 Back     alignment and structure
>1qu9_A YJGF protein; structural genomics; HET: CSP; 1.20A {Escherichia coli} SCOP: d.79.1.1 PDB: 1j7h_A 2uyk_A 2uyj_A 2uyn_A* 2uyp_A Length = 128 Back     alignment and structure
>1jd1_A Hypothetical 13.9 kDa protein in FCY2-PET117 intergenic region; translation inhibitor, structural genomics, PSI; 1.70A {Saccharomyces cerevisiae} SCOP: d.79.1.1 Length = 129 Back     alignment and structure
>1qd9_A Purine regulatory protein YABJ; perchloric acid soluble protein, purine regulation, YJGF/YER057C family, gene regulation; 1.70A {Bacillus subtilis} SCOP: d.79.1.1 Length = 124 Back     alignment and structure
>1x25_A Hypothetical UPF0076 protein ST0811; YJGF-like protein, archaea, structural genomics, UNK function; 2.00A {Sulfolobus tokodaii} SCOP: d.79.1.1 Length = 128 Back     alignment and structure
>3r0p_A L-PSP putative endoribonuclease; hydrolase; 1.90A {Uncultured organism} Length = 127 Back     alignment and structure
>1xrg_A Putative translation initiation inhibitor, YJGF family; conserved hypothetical protein, protein structure initiative, PSI; 2.20A {Clostridium thermocellum} SCOP: d.79.1.1 Length = 156 Back     alignment and structure
>2cvl_A TTHA0137, protein translation initiation inhibitor; structural genomics, NPPSFA; 1.65A {Thermus thermophilus} SCOP: d.79.1.1 PDB: 2csl_A 2cw4_A Length = 124 Back     alignment and structure
>3m1x_A Putative endoribonuclease L-PSP; structural genomics, seattle structural genomics center for infectious disease, ssgcid, unknown function; HET: FLC; 1.20A {Entamoeba histolytica} PDB: 3m4s_A 3mqw_A* Length = 148 Back     alignment and structure
>3vcz_A Endoribonuclease L-PSP; virulence, pathogenesis, infectious diseases, center for STR genomics of infectious diseases, csgid, translation; HET: GOL; 1.80A {Vibrio vulnificus} Length = 153 Back     alignment and structure
>3lme_A Possible translation initiation inhibitor; structural genomics, RPA2473, PSI-2, protein structure initiative; 2.74A {Rhodopseudomonas palustris} Length = 138 Back     alignment and structure
>3i3f_A Hypothetical protein; structural genomics, niaid, decode, infectious seattle structural genomics center for infectious disease, unknown function; 1.35A {Giardia lamblia} Length = 141 Back     alignment and structure
>3lyb_A Putative endoribonuclease; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.66A {Klebsiella pneumoniae} Length = 165 Back     alignment and structure
>1pf5_A Hypothetical protein YJGH; structural genomics, beta barrel, PSI, protein structure INI midwest center for structural genomics, MCSG; 2.50A {Escherichia coli} SCOP: d.79.1.1 Length = 131 Back     alignment and structure
>3i7t_A RV2704, putative uncharacterized protein; siras, YJGF/YER057C/UK114, homotrimer, quick SOAK NAI deriva unknown function; 1.93A {Mycobacterium tuberculosis} Length = 149 Back     alignment and structure
>2ig8_A Hypothetical protein PA3499; structural genomics, PSI-2, Pro structure initiative; 1.90A {Pseudomonas aeruginosa} Length = 144 Back     alignment and structure
>2ewc_A Conserved hypothetical protein; YJGF proteins family, COG025 putative translation initiation inhibitor; 2.15A {Streptococcus pyogenes} SCOP: d.79.1.1 Length = 126 Back     alignment and structure
>3k12_A Uncharacterized protein A6V7T0; structural genomics, unknown function, PSI-2, protein struct initiative; 1.49A {Pseudomonas aeruginosa} Length = 122 Back     alignment and structure
>3kjj_A NMB1025 protein; YJGF protein family, OPPF, structural genomics, oxford protein production facility, UN function; 1.90A {Neisseria meningitidis serogroup B} PDB: 3kjk_A Length = 128 Back     alignment and structure
>3gtz_A Putative translation initiation inhibitor; structural genomics, unknown function, PSI-2, protein struct initiative; 2.50A {Salmonella typhimurium} Length = 124 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query127
3l7q_A125 Putative translation initiation inhibitor, ALDR R 100.0
3r0p_A127 L-PSP putative endoribonuclease; hydrolase; 1.90A 100.0
3k0t_A143 Endoribonuclease L-PSP, putative; glucose binding, 100.0
2cvl_A124 TTHA0137, protein translation initiation inhibitor 100.0
2dyy_A126 UPF0076 protein PH0854; putative translation initi 100.0
1x25_A128 Hypothetical UPF0076 protein ST0811; YJGF-like pro 100.0
1qd9_A124 Purine regulatory protein YABJ; perchloric acid so 100.0
2b33_A140 Protein synthesis inhibitor, putative; putative en 100.0
1qu9_A128 YJGF protein; structural genomics; HET: CSP; 1.20A 100.0
2ig8_A144 Hypothetical protein PA3499; structural genomics, 100.0
3quw_A153 Protein MMF1; chorismate mutase fold, intact mitoc 100.0
1jd1_A129 Hypothetical 13.9 kDa protein in FCY2-PET117 inter 100.0
3m1x_A148 Putative endoribonuclease L-PSP; structural genomi 100.0
2cwj_A123 Putative endonuclease; hydrolase, endoribonucrease 100.0
1qah_A136 Perchloric acid soluble protein; alpha-beta struct 100.0
1xrg_A156 Putative translation initiation inhibitor, YJGF fa 100.0
1pf5_A131 Hypothetical protein YJGH; structural genomics, be 100.0
3lyb_A165 Putative endoribonuclease; structural genomics, PS 100.0
3vcz_A153 Endoribonuclease L-PSP; virulence, pathogenesis, i 100.0
3v4d_A134 Aminoacrylate peracid reductase RUTC; structural g 100.0
3i3f_A141 Hypothetical protein; structural genomics, niaid, 100.0
3lme_A138 Possible translation initiation inhibitor; structu 100.0
3gtz_A124 Putative translation initiation inhibitor; structu 100.0
3i7t_A149 RV2704, putative uncharacterized protein; siras, Y 100.0
3kjj_A128 NMB1025 protein; YJGF protein family, OPPF, struct 100.0
3k12_A122 Uncharacterized protein A6V7T0; structural genomic 100.0
2ewc_A126 Conserved hypothetical protein; YJGF proteins fami 100.0
2otm_A154 Hypothetical protein; structural genomics, joint c 100.0
3d01_A165 Uncharacterized protein; protein with unknown func 99.98
>3l7q_A Putative translation initiation inhibitor, ALDR R like protein; translation initiation inhibitor regulator-like; 2.50A {Streptococcus mutans} SCOP: d.79.1.0 Back     alignment and structure
Probab=100.00  E-value=4.5e-38  Score=213.98  Aligned_cols=115  Identities=36%  Similarity=0.553  Sum_probs=108.6

Q ss_pred             ccccCCCCcceEEEECCEEEEccccccCCCCCcc-cccHHHHHHHHHHHHHHHHHHcCCCccceEEEEEEeCCCCCHHHH
Q psy1836          10 VSLVGSASAFQAVQHDNTLYISGVLGIDASSGKM-AEGVENQAKQALTNMGHILKEAGGSYEHVVKTTILLNDINDFATV   88 (127)
Q Consensus        10 ~~~~~~~~ys~av~~g~~v~iSG~~~~d~~~g~~-~~d~~~Q~~~~~~ni~~~L~~~G~~~~~vv~~~vyl~d~~~~~~~   88 (127)
                      ..+.|.++|||++++|+++|+|||+|.|+.+|++ .+|+++|++++|+||+++|+++|++++||+|+++|++|+++|+.+
T Consensus         8 ~~p~p~g~ys~av~~g~~l~vSGq~~~d~~~g~~~~~d~~~Q~~~~l~ni~~~L~~ag~~~~~vvk~~vyl~d~~~~~~~   87 (125)
T 3l7q_A            8 KAPAAIGPYVQGKIVGNLLFASGQVPLSPETGQVIGTTIEEQTQQVLKNISAILTEAGTDFDHVVKTTCFLSDIDDFVPF   87 (125)
T ss_dssp             TSCCCCSSCBSEEEETTEEEEEEECSBCTTTCSBCCSSHHHHHHHHHHHHHHHHHHHTCCGGGEEEEEEEESCGGGHHHH
T ss_pred             CCCCCCCCCCCEEEECCEEEEeccCCcCCCCCCCCCcCHHHHHHHHHHHHHHHHHHcCCCHHHEEEEEEEEcCHHHHHHH
Confidence            4567889999999999999999999999978999 499999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhcCCCCCccEEEEcCCCCCCCEEEEEecccc
Q psy1836          89 NNVYGQFFKPPYPARSTFQVGKLPLIDFCLVVLGGHE  125 (127)
Q Consensus        89 ~~v~~~~f~~~~Pa~t~v~V~~L~~~~~liEi~~~~~  125 (127)
                      |++|.+||++++|+||+++|+.|| ++++||||+-..
T Consensus        88 n~v~~~~f~~~~Part~v~v~~L~-~~~~VEIe~iA~  123 (125)
T 3l7q_A           88 NEVYATAFKSDFPARSAVEVARLP-KDVKIEIEVIAE  123 (125)
T ss_dssp             HHHHHTTCCSSCCEEEEEECSBCG-GGCSEEEEEEEE
T ss_pred             HHHHHHHcCCCCCcEEEEEcccCC-CCCEEEEEEEEE
Confidence            999999999999999999999998 899999998543
>3r0p_A L-PSP putative endoribonuclease; hydrolase; 1.90A {Uncultured organism} SCOP: d.79.1.0 Back     alignment and structure
>3k0t_A Endoribonuclease L-PSP, putative; glucose binding, ER stressor, sugar binding protein; HET: BGC; 2.10A {Pseudomonas syringae PV} Back     alignment and structure
>2cvl_A TTHA0137, protein translation initiation inhibitor; structural genomics, NPPSFA; 1.65A {Thermus thermophilus} SCOP: d.79.1.1 PDB: 2csl_A 2cw4_A Back     alignment and structure
>2dyy_A UPF0076 protein PH0854; putative translation initiation inhibitor, trimer, structural genomics, NPPSFA; 2.60A {Pyrococcus horikoshii} Back     alignment and structure
>1x25_A Hypothetical UPF0076 protein ST0811; YJGF-like protein, archaea, structural genomics, UNK function; 2.00A {Sulfolobus tokodaii} SCOP: d.79.1.1 Back     alignment and structure
>1qd9_A Purine regulatory protein YABJ; perchloric acid soluble protein, purine regulation, YJGF/YER057C family, gene regulation; 1.70A {Bacillus subtilis} SCOP: d.79.1.1 Back     alignment and structure
>2b33_A Protein synthesis inhibitor, putative; putative endoribonuclease, STRU genomics, joint center for structural genomics, JCSG; 2.30A {Thermotoga maritima} SCOP: d.79.1.1 Back     alignment and structure
>1qu9_A YJGF protein; structural genomics; HET: CSP; 1.20A {Escherichia coli} SCOP: d.79.1.1 PDB: 1j7h_A 2uyk_A 2uyj_A 2uyn_A* 2uyp_A Back     alignment and structure
>2ig8_A Hypothetical protein PA3499; structural genomics, PSI-2, Pro structure initiative; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3quw_A Protein MMF1; chorismate mutase fold, intact mitochondria maintenance, mitochondrial protein, protein binding; 1.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1jd1_A Hypothetical 13.9 kDa protein in FCY2-PET117 intergenic region; translation inhibitor, structural genomics, PSI; 1.70A {Saccharomyces cerevisiae} SCOP: d.79.1.1 Back     alignment and structure
>3m1x_A Putative endoribonuclease L-PSP; structural genomics, seattle structural genomics center for infectious disease, ssgcid, unknown function; HET: FLC; 1.20A {Entamoeba histolytica} PDB: 3m4s_A 3mqw_A* Back     alignment and structure
>2cwj_A Putative endonuclease; hydrolase, endoribonucrease, structural GE NPPSFA, national project on protein structural and function analyses; 3.60A {Aeropyrum pernix} SCOP: d.79.1.1 Back     alignment and structure
>1qah_A Perchloric acid soluble protein; alpha-beta structure; 1.80A {Rattus norvegicus} SCOP: d.79.1.1 PDB: 1oni_A 1nq3_A Back     alignment and structure
>1xrg_A Putative translation initiation inhibitor, YJGF family; conserved hypothetical protein, protein structure initiative, PSI; 2.20A {Clostridium thermocellum} SCOP: d.79.1.1 Back     alignment and structure
>1pf5_A Hypothetical protein YJGH; structural genomics, beta barrel, PSI, protein structure INI midwest center for structural genomics, MCSG; 2.50A {Escherichia coli} SCOP: d.79.1.1 Back     alignment and structure
>3lyb_A Putative endoribonuclease; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.66A {Klebsiella pneumoniae} Back     alignment and structure
>3vcz_A Endoribonuclease L-PSP; virulence, pathogenesis, infectious diseases, center for STR genomics of infectious diseases, csgid, translation; HET: GOL; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3v4d_A Aminoacrylate peracid reductase RUTC; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 1.95A {Escherichia coli O6} Back     alignment and structure
>3i3f_A Hypothetical protein; structural genomics, niaid, decode, infectious seattle structural genomics center for infectious disease, unknown function; 1.35A {Giardia lamblia} Back     alignment and structure
>3lme_A Possible translation initiation inhibitor; structural genomics, RPA2473, PSI-2, protein structure initiative; 2.74A {Rhodopseudomonas palustris} SCOP: d.79.1.0 Back     alignment and structure
>3gtz_A Putative translation initiation inhibitor; structural genomics, unknown function, PSI-2, protein struct initiative; 2.50A {Salmonella typhimurium} Back     alignment and structure
>3i7t_A RV2704, putative uncharacterized protein; siras, YJGF/YER057C/UK114, homotrimer, quick SOAK NAI deriva unknown function; 1.93A {Mycobacterium tuberculosis} Back     alignment and structure
>3kjj_A NMB1025 protein; YJGF protein family, OPPF, structural genomics, oxford protein production facility, UN function; 1.90A {Neisseria meningitidis serogroup B} PDB: 3kjk_A Back     alignment and structure
>3k12_A Uncharacterized protein A6V7T0; structural genomics, unknown function, PSI-2, protein struct initiative; 1.49A {Pseudomonas aeruginosa} Back     alignment and structure
>2ewc_A Conserved hypothetical protein; YJGF proteins family, COG025 putative translation initiation inhibitor; 2.15A {Streptococcus pyogenes} SCOP: d.79.1.1 Back     alignment and structure
>2otm_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; 1.85A {Shewanella oneidensis} SCOP: d.79.1.1 Back     alignment and structure
>3d01_A Uncharacterized protein; protein with unknown function, structural genomics, PSI, MCS protein structure initiative; HET: PG5; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 127
d2cwja1116 d.79.1.1 (A:4-119) Putative endonuclease APE1501 { 2e-22
d1qaha_132 d.79.1.1 (A:) 14.5 kda translational inhibitor pro 1e-21
d1qu9a_127 d.79.1.1 (A:) Conserved 'hypothetical' protein Yjg 8e-21
d1xrga_125 d.79.1.1 (A:) Purine regulatory protein YabJ {Clos 2e-19
d1x25a1124 d.79.1.1 (A:1-124) Hypothetical protein ST0811 {Su 3e-18
d1jd1a_126 d.79.1.1 (A:) Highdosage growth inhibitor YER057cp 3e-17
d1qd9a_124 d.79.1.1 (A:) Purine regulatory protein YabJ {Baci 3e-17
d2b33a1126 d.79.1.1 (A:2-127) Putative protein synthesis inhi 5e-17
d2ewca1120 d.79.1.1 (A:3-122) Hypothetical protein SPy2060 {S 1e-16
d2cvla1124 d.79.1.1 (A:1-124) Putative translation intiation 9e-16
d2otma1152 d.79.1.1 (A:2-153) Hypothetical protein SO1960 {Sh 5e-13
d1pf5a_130 d.79.1.1 (A:) Hypothetical protein YjgH {Escherich 9e-13
>d2cwja1 d.79.1.1 (A:4-119) Putative endonuclease APE1501 {Aeropyrum pernix [TaxId: 56636]} Length = 116 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: YjgF-like
family: YjgF/L-PSP
domain: Putative endonuclease APE1501
species: Aeropyrum pernix [TaxId: 56636]

 Score = 83.3 bits (205), Expect = 2e-22
 Identities = 36/95 (37%), Positives = 58/95 (61%), Gaps = 1/95 (1%)

Query: 20  QAVQHDNTLYISGVLGIDASSGKMA-EGVENQAKQALTNMGHILKEAGGSYEHVVKTTIL 78
           QAV+    +++SG + I+  +G +   G +  AK+AL N+  I++ AG S + +VK T+ 
Sbjct: 10  QAVESGCFMFVSGQIPINPETGALEEGGFKESAKRALDNLKAIVEGAGYSMDDIVKVTVY 69

Query: 79  LNDINDFATVNNVYGQFFKPPYPARSTFQVGKLPL 113
           + DI+ F+  N VY ++F  PYPAR+   V  LPL
Sbjct: 70  ITDISRFSEFNEVYREYFNRPYPARAVVGVAALPL 104
>d1qaha_ d.79.1.1 (A:) 14.5 kda translational inhibitor protein, L-PSP {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1qu9a_ d.79.1.1 (A:) Conserved 'hypothetical' protein YjgF {Escherichia coli [TaxId: 562]} Length = 127 Back     information, alignment and structure
>d1xrga_ d.79.1.1 (A:) Purine regulatory protein YabJ {Clostridium thermocellum [TaxId: 1515]} Length = 125 Back     information, alignment and structure
>d1x25a1 d.79.1.1 (A:1-124) Hypothetical protein ST0811 {Sulfolobus tokodaii [TaxId: 111955]} Length = 124 Back     information, alignment and structure
>d1jd1a_ d.79.1.1 (A:) Highdosage growth inhibitor YER057cp (YEO7_YEAST) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 126 Back     information, alignment and structure
>d1qd9a_ d.79.1.1 (A:) Purine regulatory protein YabJ {Bacillus subtilis [TaxId: 1423]} Length = 124 Back     information, alignment and structure
>d2b33a1 d.79.1.1 (A:2-127) Putative protein synthesis inhibitor TM0215 {Thermotoga maritima [TaxId: 2336]} Length = 126 Back     information, alignment and structure
>d2ewca1 d.79.1.1 (A:3-122) Hypothetical protein SPy2060 {Streptococcus pyogenes [TaxId: 1314]} Length = 120 Back     information, alignment and structure
>d2cvla1 d.79.1.1 (A:1-124) Putative translation intiation inhibitor TTHA0137 {Thermus thermophilus [TaxId: 274]} Length = 124 Back     information, alignment and structure
>d2otma1 d.79.1.1 (A:2-153) Hypothetical protein SO1960 {Shewanella oneidensis [TaxId: 70863]} Length = 152 Back     information, alignment and structure
>d1pf5a_ d.79.1.1 (A:) Hypothetical protein YjgH {Escherichia coli [TaxId: 562]} Length = 130 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query127
d1qd9a_124 Purine regulatory protein YabJ {Bacillus subtilis 100.0
d2cvla1124 Putative translation intiation inhibitor TTHA0137 100.0
d1xrga_125 Purine regulatory protein YabJ {Clostridium thermo 100.0
d1x25a1124 Hypothetical protein ST0811 {Sulfolobus tokodaii [ 100.0
d1qu9a_127 Conserved 'hypothetical' protein YjgF {Escherichia 100.0
d2cwja1116 Putative endonuclease APE1501 {Aeropyrum pernix [T 100.0
d1jd1a_126 Highdosage growth inhibitor YER057cp (YEO7_YEAST) 100.0
d2b33a1126 Putative protein synthesis inhibitor TM0215 {Therm 100.0
d1qaha_132 14.5 kda translational inhibitor protein, L-PSP {R 100.0
d2ewca1120 Hypothetical protein SPy2060 {Streptococcus pyogen 100.0
d1pf5a_130 Hypothetical protein YjgH {Escherichia coli [TaxId 99.97
d2otma1152 Hypothetical protein SO1960 {Shewanella oneidensis 99.92
>d1qd9a_ d.79.1.1 (A:) Purine regulatory protein YabJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Bacillus chorismate mutase-like
superfamily: YjgF-like
family: YjgF/L-PSP
domain: Purine regulatory protein YabJ
species: Bacillus subtilis [TaxId: 1423]

Probab=100.00  E-value=2.2e-36  Score=203.55  Aligned_cols=112  Identities=35%  Similarity=0.564  Sum_probs=104.9

Q ss_pred             ccccCCCCcceEEEECCEEEEccccccCCCCCccc-ccHHHHHHHHHHHHHHHHHHcCCCccceEEEEEEeCCCCCHHHH
Q psy1836          10 VSLVGSASAFQAVQHDNTLYISGVLGIDASSGKMA-EGVENQAKQALTNMGHILKEAGGSYEHVVKTTILLNDINDFATV   88 (127)
Q Consensus        10 ~~~~~~~~ys~av~~g~~v~iSG~~~~d~~~g~~~-~d~~~Q~~~~~~ni~~~L~~~G~~~~~vv~~~vyl~d~~~~~~~   88 (127)
                      -.+.|.+|||||+++|+++|+|||+|.|+ ++... +|+++|++++|+||+++|+++|++++||+|+++|++|+++|+.+
T Consensus         8 ~aP~~~gpys~av~~g~~lfiSGq~~~d~-~~~~~~~~~~~Q~~~~l~ni~~iL~~aG~~~~div~~~v~~~d~~~~~~~   86 (124)
T d1qd9a_           8 HAPAAIGPYSQGIIVNNMFYSSGQIPLTP-SGEMVNGDIKEQTHQVFSNLKAVLEEAGASFETVVKATVFIADMEQFAEV   86 (124)
T ss_dssp             TSCCCCSSCBSEEEETTEEEECCBCSBCT-TSCBCCSCHHHHHHHHHHHHHHHHHHTTCCGGGEEEEEEEESCGGGHHHH
T ss_pred             CCCCCcCCCcceEEECCEEEEEeeecccc-cceeecchhHHHHHHHHHHHHHHHHHcCCCcccCceEEEEeCCHHHHHHH
Confidence            34678899999999999999999999999 55555 89999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhcCCCCCccEEEEcCCCCCCCEEEEEecc
Q psy1836          89 NNVYGQFFKPPYPARSTFQVGKLPLIDFCLVVLGG  123 (127)
Q Consensus        89 ~~v~~~~f~~~~Pa~t~v~V~~L~~~~~liEi~~~  123 (127)
                      +++|.+||++++|+||+++|+.|| ++++||||+-
T Consensus        87 ~~~~~~~f~~~~Pa~t~v~v~~L~-~~~~VEIe~i  120 (124)
T d1qd9a_          87 NEVYGQYFDTHKPARSCVEVARLP-KDALVEIEVI  120 (124)
T ss_dssp             HHHHHHHSSSCCCEEEEEECSBCG-GGCSEEEEEE
T ss_pred             HHHHHhhcCCCCCccEEEEECcCC-CCCEEEEEEE
Confidence            999999999999999999999998 7899999873
>d2cvla1 d.79.1.1 (A:1-124) Putative translation intiation inhibitor TTHA0137 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xrga_ d.79.1.1 (A:) Purine regulatory protein YabJ {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1x25a1 d.79.1.1 (A:1-124) Hypothetical protein ST0811 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1qu9a_ d.79.1.1 (A:) Conserved 'hypothetical' protein YjgF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cwja1 d.79.1.1 (A:4-119) Putative endonuclease APE1501 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1jd1a_ d.79.1.1 (A:) Highdosage growth inhibitor YER057cp (YEO7_YEAST) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b33a1 d.79.1.1 (A:2-127) Putative protein synthesis inhibitor TM0215 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qaha_ d.79.1.1 (A:) 14.5 kda translational inhibitor protein, L-PSP {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ewca1 d.79.1.1 (A:3-122) Hypothetical protein SPy2060 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1pf5a_ d.79.1.1 (A:) Hypothetical protein YjgH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2otma1 d.79.1.1 (A:2-153) Hypothetical protein SO1960 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure