Diaphorina citri psyllid: psy1861


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-
MNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKFRNFKIVYRRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKELRVLRSRCGPSPWRHILEDSVIVSEMQFEENAHGGTSALGHFVSSDSKGGCQGFGGALRGGLNRESREITLDNCKRNISSLCNQLRLNQHCLETSFNLYKMALSRNLTKGRRQILVCAACVYMTCRLEGTSHLLIDFSELLQICIFELGRTYLRLSQALCISIPSMDPCLYVLRYSNRLDFGAKTHEVTMTALRILQRMKKDMLHSGRRPNGLIGKYSCDSHVDISRVAGDDYIKSNELPRVIKECLEDADLEEETEGEIRGIGPTPAMLGMATNQDAERNDQIVDDAEDDLGDIDDEEINSYILTEGEATNKAKLWEVLNREYLTLQAERKAREEVEGKKEKKKRKPKANKATSVAKTAGEAIEKMLKEKKISTKINYDVLKSLDFTVDVNTGEMSTEQKSAPRIIENLEITSSIKKTRAKPTKEKREPTPKTPPKVAGDNYIKSNELPRVIKECLEDADLEEDMGGEIRGIGPTPAMLGMATNQDAE
ccccHHHHHHHHHHHHHHHcccccccccEEEEcccEEEEEccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEEEcccEEEEEEEccccccHHHHHHHHHHHHHHHHHccccccccEEEcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccccccccccEEEcccccCEEEcEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHcccccccccccHHHHHHHcccccHHHccccccccccccccccccccccHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccc
*******KQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKFRNFKIVYRRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKELRVLRSRCGPSPWRHILEDSVIVSEMQFEENAHGGTSALGHFV*******CQGF*G*******RESREITLDNCKRNISSLCNQLRLNQHCLETSFNLYKMALSRNLTKGRRQILVCAACVYMTCRLEGTSHLLIDFSELLQICIFELGRTYLRLSQALCISIPSMDPCLYVLRYSNRLDFGAKTHEVTMTALRILQRMKKDMLHSGRRPNGLIGKYSCDSHVDISRVAGDDYIKSNELPRVIKECLE**************************************************EINSYILTEGEATNKAKLWEVLNREYLTL*********************************************ISTKINYDVLKSLD*******************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIVYRRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKFRNFKIVYRRYAGLYFCICVDVNDNNLCYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKELRVLRSRCGPSPWRHILEDSVIVSEMQFEENAHGGTSALGHFVSSDSKGGCQGFGGALRGGLNRESREITLDNCKRNISSLCNQLRLNQHCLETSFNLYKMALSRNLTKGRRQILVCAACVYMTCRLEGTSHLLIDFSELLQICIFELGRTYLRLSQALCISIPSMDPCLYVLRYSNRLDFGAKTHEVTMTALRILQRMKKDMLHSGRRPNGLIGKYSCDSHVDISRVAGDDYIKSNELPRVIKECLEDADLEEETEGEIRGIGPTPAMLGMATNQDAERNDQIVDDAEDDLGDIDDEEINSYILTEGEATNKAKLWEVLNREYLTxxxxxxxxxxxxxxxxxxxxxPKANKATSVAKTAGEAIEKMLKEKKISTKINYDVLKSLDFTVDVNTGEMSTEQKSAPRIIENLEITSSIKKTRAKPTKEKREPTPKTPPKVAGDNYIKSNELPRVIKECLEDADLEEDMGGEIRGIGPTPAMLGMATNQDAE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
AP-2 complex subunit sigma Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein Transport via Transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 alpha and AP-2 sigma subunits are thought to contribute to the recognition of the [ED]-X-X-X-L-[LI] motif.very confidentP62744
AP-2 complex subunit sigma Component of the adaptor protein complex 2 (AP-2). Adaptor protein complexes function in protein Transport via Transport vesicles in different membrane traffic pathways. Adaptor protein complexes are vesicle coat components and appear to be involved in cargo selection and vesicle formation. AP-2 is involved in clathrin-dependent endocytosis in which cargo proteins are incorporated into vesicles surrrounded by clathrin (clathrin-coated vesicles, CCVs) which are destined for fusion with the early endosome. The clathrin lattice serves as a mechanical scaffold but is itself unable to bind directly to membrane components. Clathrin-associated adaptor protein (AP) complexes which can bind directly to both the clathrin lattice and to the lipid and protein components of membranes are considered to be the major clathrin adaptors contributing the CCV formation. AP-2 also serves as a cargo receptor to selectively sort the membrane proteins involved in receptor-mediated endocytosis. AP-2 seems to play a role in the recycling of synaptic vesicle membranes from the presynaptic surface. AP-2 recognizes Y-X-X-[FILMV] (Y-X-X-Phi) and [ED]-X-X-X-L-[LI] endocytosis signal motifs within the cytosolic tails of transmembrane cargo molecules. AP-2 may also play a role in maintaining normal post-endocytic trafficking through the ARF6-regulated, non-clathrin pathway. The AP-2 alpha and AP-2 sigma subunits are thought to contribute to the recognition of the [ED]-X-X-X-L-[LI] motif.very confidentQ17QC5
AP-2 complex subunit sigma Component of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration.confidentQ5BFF8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007275 [BP]multicellular organismal developmentconfidentGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0048856 [BP]anatomical structure developmentconfidentGO:0032502, GO:0008150
GO:0030122 [CC]AP-2 adaptor complexconfidentGO:0043227, GO:0030139, GO:0043229, GO:0071944, GO:0030117, GO:0005905, GO:0030131, GO:0030119, GO:0030118, GO:0030135, GO:0043226, GO:0030136, GO:0005737, GO:0005575, GO:0030132, GO:0031982, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0030669, GO:0031988, GO:0044433, GO:0030666, GO:0044459, GO:0048475, GO:0030665, GO:0030659, GO:0030128, GO:0045334, GO:0012505, GO:0012506, GO:0005886, GO:0030120, GO:0030125, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0031090, GO:0044424, GO:0044425, GO:0044422
GO:0048268 [BP]clathrin coat assemblyprobableGO:0022607, GO:0070271, GO:0043933, GO:0006901, GO:0006900, GO:0061024, GO:0034622, GO:0044699, GO:0071822, GO:0016044, GO:0016043, GO:0065003, GO:0071840, GO:0006461, GO:0006810, GO:0044765, GO:0044763, GO:0051234, GO:0043623, GO:0051179, GO:0006996, GO:0016192, GO:0016050, GO:0044085, GO:0008150, GO:0009987
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0008565 [MF]protein transporter activityprobableGO:0005215, GO:0022892, GO:0003674
GO:0006886 [BP]intracellular protein transportprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0019886 [BP]antigen processing and presentation of exogenous peptide antigen via MHC class IIprobableGO:0002504, GO:0019882, GO:0019884, GO:0002478, GO:0002495, GO:0002376, GO:0008150, GO:0048002
GO:0008021 [CC]synaptic vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0010171 [BP]body morphogenesisprobableGO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0030100 [BP]regulation of endocytosisprobableGO:0051049, GO:0051128, GO:0060627, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0050794
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050690 [BP]regulation of defense response to virus by virusprobableGO:0050688, GO:0048583, GO:0080134, GO:0002831, GO:0043900, GO:0008150, GO:0002697, GO:0002682, GO:0065007, GO:0050789, GO:0031347
GO:0007173 [BP]epidermal growth factor receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699, GO:0038127
GO:0016183 [BP]synaptic vesicle coatingprobableGO:0019226, GO:0035637, GO:0051649, GO:0006901, GO:0006900, GO:0061024, GO:0032501, GO:0023052, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0016185, GO:0016044, GO:0071840, GO:0016043, GO:0048488, GO:0097479, GO:0051641, GO:0006810, GO:0050877, GO:0009987, GO:0070142, GO:0044765, GO:0044763, GO:0051648, GO:0007268, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0003008, GO:0006996, GO:0044700, GO:0006897, GO:0016192, GO:0044707, GO:0016050, GO:0051640, GO:0008150
GO:0048011 [BP]neurotrophin TRK receptor signaling pathwayprobableGO:0007166, GO:0007167, GO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0007169, GO:0050789, GO:0044699, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0038179, GO:0009987, GO:0050794, GO:0008150, GO:0042221, GO:0010033, GO:0044700, GO:0071363, GO:0050896, GO:0044763
GO:0030121 [CC]AP-1 adaptor complexprobableGO:0044464, GO:0030135, GO:0043229, GO:0030117, GO:0012510, GO:0030131, GO:0030130, GO:0030119, GO:0030118, GO:0043227, GO:0043226, GO:0030136, GO:0005737, GO:0005575, GO:0031982, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044431, GO:0030125, GO:0048475, GO:0005794, GO:0030140, GO:0005798, GO:0030133, GO:0030658, GO:0030659, GO:0012505, GO:0012506, GO:0030120, GO:0030660, GO:0043234, GO:0032991, GO:0043231, GO:0030665, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0031090, GO:0044424, GO:0044425, GO:0044422, GO:0000139
GO:0042059 [BP]negative regulation of epidermal growth factor receptor signaling pathwayprobableGO:0010646, GO:0009968, GO:0050794, GO:0009966, GO:0048585, GO:0048583, GO:0042058, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:1901184, GO:1901185, GO:0050789, GO:0048523
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0007411 [BP]axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0016032 [BP]viral reproductionprobableGO:0009987, GO:0044764, GO:0008150, GO:0051704
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0007269 [BP]neurotransmitter secretionprobableGO:0019226, GO:0035637, GO:0007268, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0044699, GO:0065007, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0044765, GO:0044763, GO:0003001, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051641, GO:0044700, GO:0046903, GO:0044707, GO:0008150, GO:0006836
GO:0030276 [MF]clathrin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VGL, chain S
Confidence level:very confident
Coverage over the Query: 2-54,113-177
View the alignment between query and template
View the model in PyMOL
Template: 1AIS, chain B
Confidence level:very confident
Coverage over the Query: 242-416
View the alignment between query and template
View the model in PyMOL
Template: 3K7A, chain M
Confidence level:very confident
Coverage over the Query: 174-200,213-332
View the alignment between query and template
View the model in PyMOL
Template: 2VGL, chain S
Confidence level:very confident
Coverage over the Query: 56-89
View the alignment between query and template
View the model in PyMOL
Template: 1NGM, chain B
Confidence level:confident
Coverage over the Query: 482-505
View the alignment between query and template
View the model in PyMOL