Diaphorina citri psyllid: psy1864


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
EYSVQLTFREQWLDERLKYNDYDGRIKYLTLTEASRVWMPDLFFSNEKEGHFHNIIMPNVYIRIHPQGSVLYSISDLDNMRQCEVHMTVPQTPRKNCCRSWLAKFPTRSKRIDVISRITFPLVFALFNLTYWSTISLTLSCPMNLKLYPLDRQSCSLKMASYGWTTDDLIFLWKEGDPVQVVKNLHLPRFTLEKFYTDYCNSKTNTGAYSCLKVDLLFKREFSYYLIQIYYY
ccEEEEEEcccccccccccccccccEEEEccccccccccccEEEEcccccEEEEEECccEEEEEcccccCEEEEECccccccccccccccccccccccccccccccccccEEEEEEEccccEEEEcEEEEEEEEEEEEccccccccccccccccCEEEEEEcccccccEEEEEcccccEEEcccCEcccEEEEEEEEEEEEEEECccCEEEEEEEEEEEEcccEEEEEEEEc
EYSVQLTFREQWLDERLKYNDYDGRIKYLTLTEASRVWMPDLFFSNEKEGHFHNIIMPNVYIRIHPQGSVLYSISDLDNMRQCEVHMTVPQTPRKNCCRSWLAKFPTRSKRIDVISRITFPLVFALFNLTYWSTISLTLSCPMNLKLYPLDRQSCSLKMASYGWTTDDLIFLWKEGDPVQVVKNLHLPRFTLEKFYTDYCNSKTNTGAYSCLKVDLLFKREFSYYLIQIYYY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EYSVQLTFREQWLDERLKYNDYDGRIKYLTLTEASRVWMPDLFFSNEKEGHFHNIIMPNVYIRIHPQGSVLYSISDLDNMRQCEVHMTVPQTPRKNCCRSWLAKFPTRSKRIDVISRITFPLVFALFNLTYWSTISLTLSCPMNLKLYPLDRQSCSLKMASYGWTTDDLIFLWKEGDPVQVVKNLHLPRFTLEKFYTDYCNSKTNTGAYSCLKVDLLFKREFSYYLIQIYYY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamate-gated chloride channel Glutamate gated chloride channel that is dual gated by glutamate and avermectin.confidentQ94900

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0008068 [MF]extracellular-glutamate-gated chloride channel activityprobableGO:0003674, GO:0008509, GO:0015276, GO:0015103, GO:0022803, GO:0005253, GO:0005254, GO:0005216, GO:0005215, GO:0005230, GO:0005231, GO:0005234, GO:0022891, GO:0022892, GO:0015108, GO:0015075, GO:0022857, GO:0015267, GO:0022836, GO:0022834, GO:0022839, GO:0022838
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0005488 [MF]bindingprobableGO:0003674
GO:0048812 [BP]neuron projection morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0016933 [MF]extracellular-glycine-gated ion channel activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0005230, GO:0005231, GO:0015276, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022834, GO:0022803, GO:0022839, GO:0022838, GO:0005216
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0007218 [BP]neuropeptide signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0006811 [BP]ion transportprobableGO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0016917 [MF]GABA receptor activityprobableGO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871
GO:0097060 [CC]synaptic membraneprobableGO:0005575, GO:0044456, GO:0016020, GO:0045202

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RHW, chain A
Confidence level:very confident
Coverage over the Query: 1-75,135-231
View the alignment between query and template
View the model in PyMOL
Template: 3RHW, chain A
Confidence level:confident
Coverage over the Query: 107-137
View the alignment between query and template
View the model in PyMOL