Diaphorina citri psyllid: psy1878


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MSLIISFKTICPVAIGQLTYQVDLIGYTCQAYLIPNFTSIIEHCNLWRNFDDIQDSWQSLESIIDYYGNNQDTIVPNAGPGHWNDPDMVKSYLDYDYK
ccHHHHHHHHHHHHHHHHHHcccccEEEccccccccHHHHHHccccccccccccccHHHHHHHHHHHHHcccccccccccccccccHccccccccccc
**LIISFKTICPVAIGQLTYQVDLIGYTCQAYLIPNFTSIIEHCNLWRNFDDIQDSWQSLESIIDYYGNNQDTIVPNAGPGHWNDPDMVKSYLD****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLIISFKTICPVAIGQLTYQVDLIGYTCQAYLIPNFTSIIEHCNLWRNFDDIQDSWQSLESIIDYYGNNQDTIVPNAGPGHWNDPDMVKSYLDYDYK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alpha-N-acetylgalactosaminidase Removes terminal alpha-N-acetylgalactosamine residues from glycolipids and glycopeptides. Required for the breakdown of glycolipids.confidentQ9QWR8
Alpha-N-acetylgalactosaminidase Removes terminal alpha-N-acetylgalactosamine residues from glycolipids and glycopeptides. Required for the breakdown of glycolipids.confidentQ90744
Alpha-N-acetylgalactosaminidase Removes terminal alpha-N-acetylgalactosamine residues from glycolipids and glycopeptides. Required for the breakdown of glycolipids.confidentQ66H12

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016052 [BP]carbohydrate catabolic processprobableGO:0044238, GO:1901575, GO:0005975, GO:0071704, GO:0008150, GO:0008152, GO:0009056
GO:0009311 [BP]oligosaccharide metabolic processprobableGO:0044238, GO:0005975, GO:0071704, GO:0008150, GO:0008152, GO:0044723
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0008456 [MF]alpha-N-acetylgalactosaminidase activityprobableGO:0016787, GO:0016798, GO:0015929, GO:0003824, GO:0003674, GO:0004553
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0016936 [MF]galactoside bindingprobableGO:0097367, GO:0003674, GO:0005488
GO:0019377 [BP]glycolipid catabolic processprobableGO:0044238, GO:1901575, GO:0006643, GO:1901136, GO:1901135, GO:0009987, GO:0044710, GO:0044237, GO:0016042, GO:0044248, GO:0071704, GO:0009056, GO:0008152, GO:0046466, GO:0008150, GO:0044242, GO:0006664, GO:0044255, GO:0006629
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HG3, chain A
Confidence level:very confident
Coverage over the Query: 10-95
View the alignment between query and template
View the model in PyMOL