Diaphorina citri psyllid: psy1880

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80-

MTKPMQSFTIAMARKILLKTNNPKAISQHFLREFNRQFKPNWHCVVGHCYGACVSFQKGSFMYLSMGPFSILLFKIQDEAL

ccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccEEEEEEccccEEEEEECccEEEEEEccEEEEEEEEccccc

MTKPMQSFTIAMARKILLKTNNPKAISQHFLREFNRQFKPNWHCVVGHCYGACVSFQKGSFMYLSMGPFSILLFKIQD***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MTKPMQSFTIAMARKILLKTNNPKAISQHFLREFNRQFKPNWHCVVGHCYGACVSFQKGSFMYLSMGPFSILLFKIQDEAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dynein light chain 1, cytoplasmic	Acts as a non-catalytic accessory component of a dynein complex.	confident	Q22799
Dynein light chain 1, cytoplasmic	Acts as a non-catalytic accessory component of a dynein complex.	confident	Q24117
Dynein light chain 1, cytoplasmic	Regulates apoptotic activities of BCL2L11 by sequestering it to microtubules. Upon apoptotic stimuli the BCL2L11-DYNLL1 complex dissociates from cytoplasmic dynein and translocates to mitochondria and sequesters BCL2 thus neutralizing its antiapoptotic activity.	confident	P63167

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0043234 [CC]	protein complex	confident	GO:0005575, GO:0032991
GO:0043231 [CC]	intracellular membrane-bounded organelle	confident	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]	protein binding	confident	GO:0003674, GO:0005488
GO:0005813 [CC]	centrosome	confident	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0044444 [CC]	cytoplasmic part	confident	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0008180 [CC]	signalosome	probable	GO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0016459 [CC]	myosin complex	probable	GO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0042326 [BP]	negative regulation of phosphorylation	probable	GO:0042325, GO:0010563, GO:0019220, GO:0019222, GO:0045936, GO:0031324, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0048519, GO:0009892, GO:0050789, GO:0048523
GO:0030235 [MF]	nitric-oxide synthase regulator activity	probable	GO:0030234, GO:0003674
GO:0005868 [CC]	cytoplasmic dynein complex	probable	GO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0043226, GO:0044424, GO:0030286, GO:0043228, GO:0005875, GO:0044422
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005814 [CC]	centriole	probable	GO:0005737, GO:0005856, GO:0015630, GO:0043228, GO:0005575, GO:0043232, GO:0005813, GO:0044464, GO:0044444, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044450, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0008092 [MF]	cytoskeletal protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0042803 [MF]	protein homodimerization activity	probable	GO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0072686 [CC]	mitotic spindle	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0000776 [CC]	kinetochore	probable	GO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0035085 [CC]	cilium axoneme	probable	GO:0005737, GO:0005575, GO:0044463, GO:0043231, GO:0032838, GO:0031514, GO:0044441, GO:0044464, GO:0043229, GO:0005623, GO:0043226, GO:0044446, GO:0044444, GO:0097014, GO:0005929, GO:0044424, GO:0042995, GO:0043227, GO:0005930, GO:0044422, GO:0005622
GO:0035071 [BP]	salivary gland cell autophagic cell death	probable	GO:0010259, GO:0016271, GO:0009791, GO:0048102, GO:0002165, GO:0032501, GO:0007569, GO:0009653, GO:0007275, GO:0044699, GO:0007559, GO:0007435, GO:0007431, GO:0007552, GO:0008150, GO:0048513, GO:0022612, GO:0032502, GO:0048707, GO:0009886, GO:0035070, GO:0009987, GO:0009888, GO:0044767, GO:0012501, GO:0035272, GO:0044763, GO:0044707, GO:0048856, GO:0048731, GO:0048732
GO:0003774 [MF]	motor activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0019886 [BP]	antigen processing and presentation of exogenous peptide antigen via MHC class II	probable	GO:0002504, GO:0019882, GO:0019884, GO:0002478, GO:0002495, GO:0002376, GO:0008150, GO:0048002
GO:0048315 [BP]	conidium formation	probable	GO:0032502, GO:0000003, GO:0019954, GO:0048856, GO:0043934, GO:0044767, GO:0030436, GO:0008150, GO:0044699, GO:0009653, GO:0048646
GO:0008022 [MF]	protein C-terminus binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0005874 [CC]	microtubule	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0051017 [BP]	actin filament bundle assembly	probable	GO:0006996, GO:0007015, GO:0044699, GO:0022607, GO:0007010, GO:0030029, GO:0071822, GO:0043933, GO:0009987, GO:0030036, GO:0044085, GO:0044763, GO:0016043, GO:0008150, GO:0071840
GO:0010171 [BP]	body morphogenesis	probable	GO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0005643 [CC]	nuclear pore	probable	GO:0005635, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0031224, GO:0044446, GO:0046930, GO:0016021, GO:0016020, GO:0031967, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044428, GO:0044424, GO:0044425, GO:0005634, GO:0044422
GO:0002119 [BP]	nematode larval development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0035046 [BP]	pronuclear migration	probable	GO:0044699, GO:0051656, GO:0000003, GO:0051234, GO:0040023, GO:0009987, GO:0009566, GO:0019953, GO:0008150, GO:0022414, GO:0044702, GO:0044763, GO:0007338, GO:0051649, GO:0051647, GO:0007097, GO:0051179, GO:0051640, GO:0051641
GO:0007476 [BP]	imaginal disc-derived wing morphogenesis	probable	GO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0044764 [BP]	multi-organism cellular process	probable	GO:0009987, GO:0008150, GO:0051704
GO:0040011 [BP]	locomotion	probable	GO:0008150
GO:0040010 [BP]	positive regulation of growth rate	probable	GO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0042133 [BP]	neurotransmitter metabolic process	probable	GO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0044763, GO:0044237, GO:0023052, GO:0007154, GO:0008150, GO:0001505, GO:0008152, GO:0007268, GO:0007267, GO:0065007, GO:0065008, GO:0044699, GO:0003008
GO:0000086 [BP]	G2/M transition of mitotic cell cycle	probable	GO:0000278, GO:0008150, GO:0009987, GO:0044770, GO:0044772, GO:0044763, GO:0044699, GO:0022402, GO:0007049
GO:0009296 [BP]	flagellum assembly	probable
GO:0006809 [BP]	nitric oxide biosynthetic process	probable	GO:0044271, GO:0009987, GO:0009058, GO:0044237, GO:0044249, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0046209
GO:0006898 [BP]	receptor-mediated endocytosis	probable	GO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0019899 [MF]	enzyme binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0004857 [MF]	enzyme inhibitor activity	probable	GO:0030234, GO:0003674
GO:0045505 [MF]	dynein intermediate chain binding	probable	GO:0045502, GO:0003674, GO:0005488, GO:0005515
GO:0008039 [BP]	synaptic target recognition	probable	GO:0048666, GO:0008037, GO:0048699, GO:0032501, GO:0030182, GO:0044707, GO:0048869, GO:0030154, GO:0048468, GO:0007399, GO:0008038, GO:0044767, GO:0044763, GO:0048731, GO:0007275, GO:0008150, GO:0009987, GO:0032502, GO:0022008, GO:0044699, GO:0048856
GO:0043935 [BP]	sexual sporulation resulting in formation of a cellular spore	probable	GO:0032502, GO:0022414, GO:0048610, GO:0000003, GO:0030435, GO:0009653, GO:0048869, GO:0008150, GO:0030154, GO:0019953, GO:0044699, GO:0034293, GO:0044767, GO:0003006, GO:0022402, GO:0007049, GO:0044763, GO:0009987, GO:0043934, GO:0048646, GO:0048856
GO:0031122 [BP]	cytoplasmic microtubule organization	probable	GO:0006996, GO:0007017, GO:0007010, GO:0071822, GO:0043933, GO:0009987, GO:0016043, GO:0008150, GO:0000226, GO:0071840, GO:0044763, GO:0044699
GO:0040020 [BP]	regulation of meiosis	probable	GO:0051445, GO:0051726, GO:2000241, GO:0010564, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0043652 [BP]	engulfment of apoptotic cell	probable	GO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0006911, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0043277, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0005777 [CC]	peroxisome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0042579, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042127 [BP]	regulation of cell proliferation	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0019904 [MF]	protein domain specific binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0030473 [BP]	nuclear migration along microtubule	probable	GO:0072384, GO:0006928, GO:0051656, GO:0044699, GO:0040023, GO:0030705, GO:0009987, GO:0006810, GO:0044765, GO:0010970, GO:0008150, GO:0051649, GO:0051647, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0007017, GO:0046907, GO:0007018, GO:0044763, GO:0007097
GO:0006355 [BP]	regulation of transcription, DNA-dependent	probable	GO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0006351 [BP]	transcription, DNA-dependent	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045019 [BP]	negative regulation of nitric oxide biosynthetic process	probable	GO:0009889, GO:0009892, GO:0019222, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0050794, GO:0008150, GO:0045428, GO:0065007, GO:0051171, GO:0051172, GO:0048519, GO:0050789, GO:0048523
GO:0006914 [BP]	autophagy	probable	GO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056
GO:0007290 [BP]	spermatid nucleus elongation	probable	GO:0048610, GO:0048232, GO:0060429, GO:0007286, GO:0048468, GO:0019953, GO:0007276, GO:0044699, GO:0000003, GO:0048869, GO:0016043, GO:0071840, GO:0030855, GO:0002064, GO:0048515, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0009888, GO:0007281, GO:0003006, GO:0007283, GO:0044763, GO:0022412, GO:0007289, GO:0006996, GO:0006997, GO:0044702, GO:0022414, GO:0048856, GO:0044767, GO:0030154, GO:0008150
GO:0007291 [BP]	sperm individualization	probable	GO:0048610, GO:0048232, GO:0007286, GO:0048468, GO:0019953, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0000003, GO:0048869, GO:0007349, GO:0007276, GO:0030855, GO:0002064, GO:0048515, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0008150, GO:0022412, GO:0007281, GO:0044702, GO:0044707, GO:0003006, GO:0048856, GO:0048646, GO:0044763, GO:0009987
GO:0006260 [BP]	DNA replication	probable	GO:0071704, GO:1901576, GO:0044238, GO:0008152, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0044249, GO:0009058, GO:0009059, GO:0006807, GO:0034645, GO:0006259, GO:0008150, GO:1901360, GO:0046483
GO:0040035 [BP]	hermaphrodite genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0008407 [BP]	chaeta morphogenesis	probable	GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0044699, GO:0048731, GO:0009653, GO:0007275, GO:0022416
GO:0048477 [BP]	oogenesis	probable	GO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0007292, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0000003
GO:0000132 [BP]	establishment of mitotic spindle orientation	probable	GO:0008104, GO:0051653, GO:0007163, GO:0000226, GO:0030010, GO:0051656, GO:0044699, GO:0040001, GO:0071840, GO:0016043, GO:0008150, GO:0007049, GO:0033036, GO:0006996, GO:0000278, GO:0051294, GO:0009987, GO:0051293, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051640, GO:0051641, GO:0031503, GO:0007017, GO:0007010, GO:0022402
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0043086 [BP]	negative regulation of catalytic activity	probable	GO:0019222, GO:0050790, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0050789
GO:0002009 [BP]	morphogenesis of an epithelium	probable	GO:0032502, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0034454 [BP]	microtubule anchoring at centrosome	probable	GO:0008104, GO:0000226, GO:0051651, GO:0044699, GO:0070727, GO:0072393, GO:0016043, GO:0065007, GO:0071840, GO:0033036, GO:0034453, GO:0034613, GO:0032507, GO:0009987, GO:0045185, GO:0008150, GO:0051235, GO:0051179, GO:0051641, GO:0006996, GO:0007017, GO:0007010, GO:0065008, GO:0044763
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YO3, chain A
Confidence level:very confident
Coverage over the Query: 1-77
View the alignment between query and template
View the model in PyMOL