Diaphorina citri psyllid: psy1888

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380------
MLDTELTGGAQDTIYLCNFRVSVDGEWLCLKQLDDVEVRVRDPPELRSPSPEPPLFVARNPVIIERRNLVNISKLIVKELIETSQKHGRMLDSDHMPLQHFFIVLEHVLRHGLKPKKGLLGPKKELWDILQLVEKLNPEASDITASVRDLPTVKTHMGRARAWLRLALMQKKLADYLQVLVDHRDDILVEYFETDALLMSDEAIVILGKLLSLNVIDCNLCVKEEDLDCQQGVIDFSLYLRSACYHDHPEEVTSQVEDNMSLVLDQKNYIEELNRHLNATVGNLQTQVESLTTTNALMREDLSIAEKNLRILIQENENLKNQLANSSQHTSNLSVHEVGLKAEMEVAMKLLERDVHQKQDTIIELRRQLEDIKMINLEMYKKLQAL
cccccccccccccEEEEEEEEEccccHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHccccHHHHHHHHcccccccccHHHHHHHHHHHHHcHHHHHHHHHHHccccHHcccccccccccccHHHHHHHHHccccccccccEEcccccccccccccHHHHHHccccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
*********AQDTIYLCNFRVSVDGEWLCLKQLDDVEVR*******************RNPVIIERRNLVNISKLIVKELIETSQKHGRMLDSDHMPLQHFFIVLEHVLRHGLKPKKGLLGPKKELWDILQLVEKLNPEASDITASVRDLPTVKTHMGRARAWLRLALMQKKLADYLQVLVDHRDDILVEYFETDALLMSDEAIVILGKLLSLNVIDCNLCVKEEDLDCQQGVIDFSLYLRSACYHD**********DNMSLVLDQKNYIEELNRHLNATVGNLQTQVESLTTTNALMREDLSIAEKNLRILIQ***********************VGLKAEMEVAMKLLERDVHQKQDTIIELRRQLEDIKMINLEMYKKLQAL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDTELTGGAQDTIYLCNFRVSVDGEWLCLKQLDDVEVRVRDPPELRSPSPEPPLFVARNPVIIERRNLVNISKLIVKELIETSQKHGRMLDSDHMPLQHFFIVLEHVLRHGLKPKKGLLGPKKELWDILQLVEKLNPEASDITASVRDLPTVKTHMGRARAWLRLALMQKKLADYLQVLVDHRDDILVEYFETDALLMSDEAIVILGKLLSLNVIDCNLCVKEEDLDCQQGVIDFSLYLRSACYHDHPEEVTSQVEDNMSLVLDQKNYIEELNRHLNATVGNLQTQVESLTTTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTSNLSVHEVGLxxxxxxxxxxxxxxxxxxxxxxxxxxxxLEDIKMINLEMYKKLQAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein RUFY3 Implicated in the formation of a single axon by developing neurons. May inhibit the formation of additional axons by inhibition of PI3K in minor neuronal processes.confidentQ9D394
Protein RUFY3 Implicated in the formation of a single axon by developing neurons. May inhibit the formation of additional axons by inhibition of PI3K in minor neuronal processes.confidentQ5FVJ0
Protein RUFY3 Implicated in the formation of a single axon by developing neurons. May inhibit the formation of additional axons by inhibition of PI3K in minor neuronal processes.confidentQ7L099

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030175 [CC]filopodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0050771 [BP]negative regulation of axonogenesisprobableGO:0022604, GO:0044707, GO:0051239, GO:0022603, GO:0030154, GO:0051129, GO:0051128, GO:0060284, GO:0031345, GO:0031344, GO:0044699, GO:0050767, GO:0048869, GO:0050768, GO:0050789, GO:0045664, GO:0010769, GO:0065007, GO:0010721, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0044763, GO:0010975, GO:0048731, GO:0022008, GO:0051093, GO:0048699, GO:0050770, GO:0007399, GO:0048856, GO:0051960, GO:2000026, GO:0007275, GO:0008150, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DWK, chain A
Confidence level:very confident
Coverage over the Query: 63-231
View the alignment between query and template
View the model in PyMOL
Template: 3CWZ, chain B
Confidence level:very confident
Coverage over the Query: 58-245
View the alignment between query and template
View the model in PyMOL
Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 260-384
View the alignment between query and template
View the model in PyMOL