Diaphorina citri psyllid: psy1893


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------
MDSRQTEDAAAVLSVLVAGSCMGLTLYTGSHIPDAVGSFLVGGILGCVAYFIVSSNIEALVGRSIPDDYLAQKMLLQS
cccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcc
*****TEDAAAVLSVLVAGSCMGLTLYTGSHIPDAVGSFLVGGILGCVAYFIVSSNIEALVGRSIPDDYLAQKMLLQ*
xxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSRQTEDAAAVLSVLVAGSCMGLTLYTGSHIPDAVGSFLVGGILGCVAYFIVSSNIEALVGRSIPDDYLAQKMLLQS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc transporter 9 Plays a role as nuclear receptor coactivator.confidentQ5PQZ3
Zinc transporter 9 Plays a role in the p160 coactivator signaling pathway that mediates transcriptional activation by nuclear receptors. Plays a role in transcriptional activation of Wnt-responsive genes.confidentQ5R4H0
Zinc transporter 9 Plays a role in the p160 coactivator signaling pathway that mediates transcriptional activation by nuclear receptors (By similarity). Plays a role in transcriptional activation of Wnt-responsive genes.confidentQ6PML9

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3J1Z, chain P
Confidence level:confident
Coverage over the Query: 27-76
View the alignment between query and template
View the model in PyMOL
Template: 3H90, chain A
Confidence level:probable
Coverage over the Query: 7-62
View the alignment between query and template
View the model in PyMOL