Diaphorina citri psyllid: psy1894


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MNPASKQFVQDLIASEKILIFSKSYCPYCKMAKDVFQKLKVTPKTVELDHRDDGDSIQDVLLEITGARSQPSDNDLEEKPKAEKKILEIPVEAVAKPRIRVDLSVSSTERNFITPNRAMSDFLLKQSDLEGLKVIKRRSPYENEPPISVYWRKDVEAKAIQVWGSKERLLQERLKNELERKYQQQHIFTMKRKLRDYRREQGSLADQKMAEKAGLFGLLYPISMLRLT
ccHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccEEEEcHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccc
****SKQ*VQDLIASEKILIFSKSYCPYCKMAKDVFQKLKVTPKTVELDHRDDGDSIQDVLLEITGARSQ**DNDLEEKPKAEKKILEIPVEAVAKPRIRVDLSVSSTERNFITPNRAMSDFLLKQSDLEGLKVIKRRSPYENEPPISVYWRKDVEAKAIQVWGSKERLLQERL*******YQQQHIFTM*********************KAGLFGLLYPISMLRLT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPASKQFVQDLIASEKILIFSKSYCPYCKMAKDVFQKLKVTPKTVELDHRDDGDSIQDVLLEITGARSQPSDNDLEEKPKAEKKILEIPVEAVAKPRIRVDLSVSSTERNFITPNRAMSDFLLKQSDLEGLKVIKRRSPYENEPPISVYWRKDVEAKAIQVWGSKERLLQERLKNELERKYQQQHIFTMKRKLRDYRREQGSLADQKMAEKAGLFGLLYPISMLRLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutaredoxin-C4 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.confidentQ8LFQ6
Monothiol glutaredoxin-S6 May only reduce GSH-thiol disulfides, but not protein disulfides.confidentQ6H628

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004364 [MF]glutathione transferase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ENK, chain A
Confidence level:very confident
Coverage over the Query: 102-198
View the alignment between query and template
View the model in PyMOL
Template: 3H8Q, chain A
Confidence level:very confident
Coverage over the Query: 3-98
View the alignment between query and template
View the model in PyMOL