Psyllid ID: psy1894


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MNPASKQFVQDLIASEKILIFSKSYCPYCKMAKDVFQKLKVTPKTVELDHRDDGDSIQDVLLEITGARSQPSDNDLEEKPKAEKKILEIPVEAVAKPRIRVDLSVSSTERNFITPNRAMSDFLLKQSDLEGLKVIKRRSPYENEPPISVYWRKDVEAKAIQVWGSKERLLQERLKNELERKYQQQHIFTMKRKLRDYRREQGSLADQKMAEKAGLFGLLYPISMLRLT
ccHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccEEEEHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccccc
cccHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHcccccccccccccHHHHHHcccccHHHHHHccccccEcccHHHHcccccHHHHHHHHHHccccHHHHcHHHcccccccccccEEEEEccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHcccEEEEEEHHHHccc
MNPASKQFVQDLIASEKILIFSksycpyckMAKDVFQKLkvtpktveldhrddgdSIQDVLLEItgarsqpsdndleekpkAEKKILeipveavakprirvdlsvssternfitpnramsdfllkqsdleglkvikrrspyeneppisvywrkDVEAKAIQVWGSKERLLQERLKNELERKYQQQHIFTMKRKLRDYRREQGSLADQKMAEKAGLFGllypismlrlt
MNPASKQFVQDLIASEKILIFSKSYCPYCKMAKDVFQKLKVTpktveldhrddgdSIQDVLLEItgarsqpsdndleekpkaekkileipveavakprirvdlsvssternfitpnramsdfllkQSDLEglkvikrrspyeneppisvywrkdVEAKAIQVWGSKERLLQERLKNELERKYQQQHIFTMKRKLRDYRREQGSLADQKMAEkaglfgllypismlrlt
MNPASKQFVQDLIASEKILIFSKSYCPYCKMAKDVFQKLKVTPKTVELDHRDDGDSIQDVLLEITGARSQPSDNDLEEKPKAEKKILEIPVEAVAKPRIRVDLSVSSTERNFITPNRAMSDFLLKQSDLEGLKVIKRRSPYENEPPISVYWRKDVEAKAIQVWGSKERLLQERLKNELERKYQQQHIFTMKRKLRDYRREQGSLADQKMAEKAGLFGLLYPISMLRLT
*******FVQDLIASEKILIFSKSYCPYCKMAKDVFQKLKVTPKTVEL**********DVLL************************LEIPVEAVAKPRIRVDLSV*****NFITPNRAMSDFLLKQSDLEGLKVIKR***Y**EPPISVYWRKDVEAKAIQVWGSKERLLQERL*******YQQQHIFTM*********************KAGLFGLLYPISM****
****SKQ*VQDLIASEKILIFSKSYCPYCKMAKDVFQKLKVTPKTVELDHRDDGDSIQDVLLEITGARSQPSDNDLEEKPKAEKKILEIPVEAVAKPRIRVDLSVSSTERNFITPNRAMSDFLLKQSDLEGLKVIKRRSPYENEPPISVYWRKDVEAKAIQVWGSKERL*********************************************LFGLLYPISMLRLT
********VQDLIASEKILIFSKSYCPYCKMAKDVFQKLKVTPKTVELDHRDDGDSIQDVLLEITGARS***********KAEKKILEIPVEAVAKPRIRVDLSVSSTERNFITPNRAMSDFLLKQSDLEGLKVIKRRSPYENEPPISVYWRKDVEAKAIQVWGSKERLLQERLKNELERKYQQQHIFTMKRKLRDYRREQGSLADQKMAEKAGLFGLLYPISMLRLT
****SKQFVQDLIASEKILIFSKSYCPYCKMAKDVFQKLKVTPKTVELDHRDDGDSIQDVLLEITGARSQ**DNDLEEKPKAEKKILEIPVEAVAKPRIRVDLSVSSTERNFITPNRAMSDFLLKQSDLEGLKVIKRRSPYENEPPISVYWRKDVEAKAIQVWGSKERLLQERLKNELERKYQQQHIFTMKRKLRDYRREQGSLADQKMAEKAGLFGLLYPISMLRLT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPASKQFVQDLIASEKILIFSKSYCPYCKMAKDVFQKLKVTPKTVELDHRDDGDSIQDVLLEITGARSQPSDNDLEEKPKAEKKILEIPVEAVAKPRIRVDLSVSSTERNFITPNRAMSDFLLKQSDLEGLKVIKRRSPYENEPPISVYWRKDVEAKAIQVWGSKERLLQERLKNELERKYQQQHIFTMKRKLRDYRREQGSLADQKMAEKAGLFGLLYPISMLRLT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query228 2.2.26 [Sep-21-2011]
Q5PQZ3 573 Zinc transporter 9 OS=Dan yes N/A 0.530 0.211 0.429 6e-19
Q6PML9 568 Zinc transporter 9 OS=Hom yes N/A 0.811 0.325 0.328 9e-18
Q5R4H0 569 Zinc transporter 9 OS=Pon yes N/A 0.811 0.325 0.333 9e-18
Q5IRJ6 567 Zinc transporter 9 OS=Mus yes N/A 0.469 0.188 0.455 3e-17
Q6DCE3 559 Zinc transporter 9 OS=Xen N/A N/A 0.640 0.261 0.351 1e-15
Q8LFQ6135 Glutaredoxin-C4 OS=Arabid yes N/A 0.280 0.474 0.609 5e-15
Q9FVX1130 Glutaredoxin-C3 OS=Arabid no N/A 0.280 0.492 0.593 1e-14
Q6H628131 Monothiol glutaredoxin-S6 yes N/A 0.280 0.488 0.531 3e-12
Q0DAE4136 Glutaredoxin-C8 OS=Oryza no N/A 0.298 0.5 0.492 1e-11
Q54GP8100 Glutaredoxin OS=Dictyoste yes N/A 0.276 0.63 0.492 3e-11
>sp|Q5PQZ3|ZNT9_DANRE Zinc transporter 9 OS=Danio rerio GN=slc30a9 PE=2 SV=1 Back     alignment and function desciption
 Score = 94.4 bits (233), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 86/128 (67%), Gaps = 7/128 (5%)

Query: 79  KPKAEKKI--LEIPVEAVAKPRIRVDLSVSSTERNFITPNRAMSDFLLKQSDLEGLKVIK 136
           KP+   K   +++ V AV K R   +  +  T+ NFIT  RAM++F LK SDLE L+ I+
Sbjct: 103 KPQGLTKAESIQVKVRAVLKKR---EYGLKYTQNNFITAVRAMNEFCLKPSDLEHLRKIR 159

Query: 137 RRSPYENEPPISVYWRKDVEAKAIQVWGSKERLLQER-LKNELERKYQQQHIFTMKRKLR 195
           RRSP+++    +V+ R DVEAKA++VWGS+E L +ER  + E+ER+Y Q++IF  ++ L+
Sbjct: 160 RRSPHDDTEAFTVFLRSDVEAKALEVWGSQEALARERDQRKEVEREY-QENIFRNQKLLK 218

Query: 196 DYRREQGS 203
           +Y+   G+
Sbjct: 219 EYKDFWGN 226




Plays a role as nuclear receptor coactivator.
Danio rerio (taxid: 7955)
>sp|Q6PML9|ZNT9_HUMAN Zinc transporter 9 OS=Homo sapiens GN=SLC30A9 PE=1 SV=1 Back     alignment and function description
>sp|Q5R4H0|ZNT9_PONAB Zinc transporter 9 OS=Pongo abelii GN=SLC30A9 PE=2 SV=1 Back     alignment and function description
>sp|Q5IRJ6|ZNT9_MOUSE Zinc transporter 9 OS=Mus musculus GN=Slc30a9 PE=1 SV=2 Back     alignment and function description
>sp|Q6DCE3|ZNT9_XENLA Zinc transporter 9 OS=Xenopus laevis GN=slc30a9 PE=2 SV=1 Back     alignment and function description
>sp|Q8LFQ6|GRXC4_ARATH Glutaredoxin-C4 OS=Arabidopsis thaliana GN=GRXC4 PE=2 SV=2 Back     alignment and function description
>sp|Q9FVX1|GRXC3_ARATH Glutaredoxin-C3 OS=Arabidopsis thaliana GN=GRXC3 PE=2 SV=1 Back     alignment and function description
>sp|Q6H628|GRXS6_ORYSJ Monothiol glutaredoxin-S6 OS=Oryza sativa subsp. japonica GN=GRXS6 PE=2 SV=1 Back     alignment and function description
>sp|Q0DAE4|GRXC8_ORYSJ Glutaredoxin-C8 OS=Oryza sativa subsp. japonica GN=GRXC8 PE=2 SV=2 Back     alignment and function description
>sp|Q54GP8|GLRX_DICDI Glutaredoxin OS=Dictyostelium discoideum GN=grxA PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query228
383850532 597 PREDICTED: zinc transporter 9-like [Mega 0.530 0.202 0.715 3e-41
242005849 761 conserved hypothetical protein [Pediculu 0.557 0.166 0.664 7e-41
307204400 539 Zinc transporter 9 [Harpegnathos saltato 0.530 0.224 0.699 1e-40
157103781 632 hypothetical protein AaeL_AAEL003964 [Ae 0.539 0.194 0.701 2e-40
322793203 609 hypothetical protein SINV_00858 [Solenop 0.530 0.198 0.682 2e-39
307167802 612 Zinc transporter 9 [Camponotus floridanu 0.596 0.222 0.625 1e-38
91081083 488 PREDICTED: similar to CG8632 CG8632-PA [ 0.530 0.247 0.658 1e-37
195582833 655 GD10910 [Drosophila simulans] gi|1941932 0.644 0.224 0.543 7e-37
195333846 650 GM21415 [Drosophila sechellia] gi|194125 0.644 0.226 0.543 1e-36
345480939 617 PREDICTED: zinc transporter 9-like [Naso 0.513 0.189 0.739 1e-36
>gi|383850532|ref|XP_003700849.1| PREDICTED: zinc transporter 9-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/123 (71%), Positives = 101/123 (82%), Gaps = 2/123 (1%)

Query: 95  AKPRIRVDLSVSSTERNFITPNRAMSDFLLKQSDLEGLKVIKRRSPYENEPPISVYWRKD 154
           AK R ++D S SS ERNFITP RAMSDFLLK SDLE L   KRRSPYE EPPI+VYWRKD
Sbjct: 142 AKKRSKMDKSASSLERNFITPVRAMSDFLLKPSDLEDLPKTKRRSPYEFEPPITVYWRKD 201

Query: 155 VEAKAIQVWGSKERLLQERLKNELERKYQQQHIFTMKRKLRDYRREQGSLADQKMAEKAG 214
           VEAKA++VWGSKE LL+ERL+NELE+K  QQ+IFT+KR+LRDYRRE GS AD  +  + G
Sbjct: 202 VEAKALEVWGSKEALLKERLRNELEQKAHQQNIFTVKRRLRDYRREMGSKAD--VVPQEG 259

Query: 215 LFG 217
           LFG
Sbjct: 260 LFG 262




Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242005849|ref|XP_002423772.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212506988|gb|EEB11034.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307204400|gb|EFN83131.1| Zinc transporter 9 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|157103781|ref|XP_001648127.1| hypothetical protein AaeL_AAEL003964 [Aedes aegypti] gi|108880482|gb|EAT44707.1| AAEL003964-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|322793203|gb|EFZ16860.1| hypothetical protein SINV_00858 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307167802|gb|EFN61247.1| Zinc transporter 9 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|91081083|ref|XP_975475.1| PREDICTED: similar to CG8632 CG8632-PA [Tribolium castaneum] gi|270005302|gb|EFA01750.1| hypothetical protein TcasGA2_TC007348 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195582833|ref|XP_002081230.1| GD10910 [Drosophila simulans] gi|194193239|gb|EDX06815.1| GD10910 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195333846|ref|XP_002033597.1| GM21415 [Drosophila sechellia] gi|194125567|gb|EDW47610.1| GM21415 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|345480939|ref|XP_001606946.2| PREDICTED: zinc transporter 9-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query228
FB|FBgn0033762 660 CG8632 [Drosophila melanogaste 0.622 0.215 0.532 2.2e-34
ZFIN|ZDB-GENE-040724-254 573 slc30a9 "solute carrier family 0.552 0.219 0.421 7.9e-21
UNIPROTKB|B5U335 566 SLC30A9 "Solute carrier family 0.675 0.272 0.378 3.4e-20
UNIPROTKB|F1PHJ0 534 SLC30A9 "Uncharacterized prote 0.662 0.282 0.373 8e-20
UNIPROTKB|F1MDV2 566 SLC30A9 "Uncharacterized prote 0.622 0.250 0.395 9.3e-20
UNIPROTKB|F1NWL2 472 SLC30A9 "Uncharacterized prote 0.587 0.283 0.397 2e-19
UNIPROTKB|Q6PML9 568 SLC30A9 "Zinc transporter 9" [ 0.811 0.325 0.343 4.2e-19
MGI|MGI:1923690 567 Slc30a9 "solute carrier family 0.600 0.241 0.401 1.9e-18
RGD|1593180 567 Slc30a9 "solute carrier family 0.548 0.220 0.412 3.1e-18
FB|FBgn0034658116 Grx-1 "Grx-1" [Drosophila mela 0.311 0.612 0.549 2.5e-17
FB|FBgn0033762 CG8632 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 379 (138.5 bits), Expect = 2.2e-34, P = 2.2e-34
 Identities = 83/156 (53%), Positives = 108/156 (69%)

Query:    69 SQPSDNDLEEKPKAEKKILEIPVEAVAKPRIRVDLSVSSTERNFITPNRAMSDFLLKQSD 128
             ++ +   +   P AE   +  P   +   R R D   +S ERNF+TPNRA+SDFLL  + 
Sbjct:   178 AEKAGEGIRTSPPAE---VTPPAPVIPLKRPRFDYR-ASLERNFVTPNRAISDFLLTAAQ 233

Query:   129 LEGLKVIKRRSPYENEPPISVYWRKDVEAKAIQVWGSKERLLQERLKNELERK-YQQQH- 186
             LE L  IKRRSPYE EPP++VYWR+DVEAKA++VWGSKE LL+ERLK E+ERK YQQ + 
Sbjct:   234 LESLPKIKRRSPYEQEPPMTVYWRRDVEAKAVEVWGSKENLLRERLKREVERKQYQQIYD 293

Query:   187 ---IFTMKRKLRDYRREQGS-----LADQKMAEKAG 214
                +FT+KR+LRDYRRE GS     L ++K +EK+G
Sbjct:   294 SADLFTVKRRLRDYRREMGSRTKVMLDNRKESEKSG 329




GO:0055085 "transmembrane transport" evidence=IEA
GO:0006812 "cation transport" evidence=IEA
GO:0008324 "cation transmembrane transporter activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0016021 "integral to membrane" evidence=IEA
ZFIN|ZDB-GENE-040724-254 slc30a9 "solute carrier family 30 (zinc transporter), member 9" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B5U335 SLC30A9 "Solute carrier family 30 member 9" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PHJ0 SLC30A9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MDV2 SLC30A9 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWL2 SLC30A9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6PML9 SLC30A9 "Zinc transporter 9" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1923690 Slc30a9 "solute carrier family 30 (zinc transporter), member 9" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1593180 Slc30a9 "solute carrier family 30 (zinc transporter), member 9" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0034658 Grx-1 "Grx-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8LFQ6GRXC4_ARATHNo assigned EC number0.60930.28070.4740yesN/A
Q6H628GRXS6_ORYSJNo assigned EC number0.53120.28070.4885yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query228
cd0341982 cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) fam 1e-23
TIGR0218084 TIGR02180, GRX_euk, Glutaredoxin 1e-18
cd0206672 cd02066, GRX_family, Glutaredoxin (GRX) family; co 6e-11
pfam0046260 pfam00462, Glutaredoxin, Glutaredoxin 2e-10
COG069580 COG0695, GrxC, Glutaredoxin and related proteins [ 1e-07
TIGR0218999 TIGR02189, GlrX-like_plant, Glutaredoxin-like fami 8e-07
PHA03050108 PHA03050, PHA03050, glutaredoxin; Provisional 2e-05
cd0297673 cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is 9e-05
cd0341875 cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) fam 4e-04
TIGR0218179 TIGR02181, GRX_bact, Glutaredoxin, GrxC family 5e-04
cd0302972 cd03029, GRX_hybridPRX5, Glutaredoxin (GRX) family 7e-04
>gnl|CDD|239511 cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
 Score = 89.9 bits (224), Expect = 1e-23
 Identities = 30/55 (54%), Positives = 39/55 (70%)

Query: 17 KILIFSKSYCPYCKMAKDVFQKLKVTPKTVELDHRDDGDSIQDVLLEITGARSQP 71
           +++FSKSYCPYCK AK + ++L V P  VELD  +DG  IQD L E+TG R+ P
Sbjct: 1  PVVVFSKSYCPYCKRAKSLLKELGVKPAVVELDQHEDGSEIQDYLQELTGQRTVP 55


GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH -> GSH reductase -> GSH -> GRX -> protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known including human GRX1 and GRX2, which are members of this subfamily. Also included in this subfamily are the N-terminal GRX domains of proteins similar to human thioredoxin reductase 1 and 3. Length = 82

>gnl|CDD|233765 TIGR02180, GRX_euk, Glutaredoxin Back     alignment and domain information
>gnl|CDD|239017 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|215931 pfam00462, Glutaredoxin, Glutaredoxin Back     alignment and domain information
>gnl|CDD|223767 COG0695, GrxC, Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233771 TIGR02189, GlrX-like_plant, Glutaredoxin-like family Back     alignment and domain information
>gnl|CDD|165343 PHA03050, PHA03050, glutaredoxin; Provisional Back     alignment and domain information
>gnl|CDD|239274 cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>gnl|CDD|239510 cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|233766 TIGR02181, GRX_bact, Glutaredoxin, GrxC family Back     alignment and domain information
>gnl|CDD|239327 cd03029, GRX_hybridPRX5, Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 228
TIGR00598172 rad14 DNA repair protein. This family is based on 100.0
KOG4017|consensus274 100.0
COG5145292 RAD14 DNA excision repair protein [DNA replication 99.97
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 99.89
PHA03050108 glutaredoxin; Provisional 99.89
PRK10824115 glutaredoxin-4; Provisional 99.89
KOG1752|consensus104 99.88
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 99.87
PF0518152 XPA_C: XPA protein C-terminus; InterPro: IPR022656 99.85
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 99.83
KOG2802|consensus 503 99.81
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 99.78
PTZ00062204 glutaredoxin; Provisional 99.78
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 99.78
PRK1063883 glutaredoxin 3; Provisional 99.78
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 99.77
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 99.77
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 99.76
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 99.76
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 99.73
PRK1120085 grxA glutaredoxin 1; Provisional 99.72
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 99.72
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 99.7
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 99.69
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 99.67
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 99.67
COG0278105 Glutaredoxin-related protein [Posttranslational mo 99.61
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 99.59
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 99.57
PRK1032981 glutaredoxin-like protein; Provisional 99.55
KOG0911|consensus227 99.41
cd0303092 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 99.4
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 99.39
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 99.33
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 99.23
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 99.18
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 98.94
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 98.91
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 98.79
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 98.78
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 98.78
KOG2824|consensus281 98.73
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 98.69
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 98.62
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 98.6
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 98.59
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 98.59
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 98.53
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 98.51
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 98.5
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 98.49
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 98.48
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 98.48
PF0490899 SH3BGR: SH3-binding, glutamic acid-rich protein; I 98.43
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 98.43
PHA0212575 thioredoxin-like protein 98.39
PRK01655131 spxA transcriptional regulator Spx; Reviewed 98.35
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 98.35
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 98.35
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 98.32
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 98.23
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 98.22
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 98.21
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 98.2
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 98.2
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 98.16
PRK13344132 spxA transcriptional regulator Spx; Reviewed 98.16
PRK12559131 transcriptional regulator Spx; Provisional 98.12
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 98.08
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 98.06
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 98.05
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 98.05
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 98.04
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 98.01
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 98.0
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 97.97
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 97.87
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 97.85
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 97.83
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 97.83
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 97.78
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 97.77
KOG3029|consensus370 97.76
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 97.76
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 97.73
PRK09481211 sspA stringent starvation protein A; Provisional 97.73
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 97.73
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 97.7
cd0294793 TRX_family TRX family; composed of two groups: Gro 97.68
PRK10387210 glutaredoxin 2; Provisional 97.68
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 97.65
PHA02278103 thioredoxin-like protein 97.62
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 97.58
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 97.56
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 97.56
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 97.52
COG454585 Glutaredoxin-related protein [Posttranslational mo 97.51
PTZ0005198 thioredoxin; Provisional 97.49
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 97.48
COG1393117 ArsC Arsenate reductase and related proteins, glut 97.46
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 97.46
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 97.46
KOG0910|consensus150 97.45
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 97.44
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 97.39
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 97.37
PRK10026141 arsenate reductase; Provisional 97.35
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 97.34
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 97.33
PRK15113214 glutathione S-transferase; Provisional 97.27
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 97.25
PRK10853118 putative reductase; Provisional 97.24
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 97.24
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 97.21
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 97.19
PRK09381109 trxA thioredoxin; Provisional 97.15
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 97.15
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 97.14
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 97.14
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 97.13
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 97.08
PLN02473214 glutathione S-transferase 97.07
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 97.04
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 97.03
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 97.03
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 97.0
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 96.98
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 96.98
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 96.96
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 96.94
PLN02378213 glutathione S-transferase DHAR1 96.93
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 96.92
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 96.84
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 96.84
cd02962152 TMX2 TMX2 family; composed of proteins similar to 96.83
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 96.82
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 96.78
PLN02817265 glutathione dehydrogenase (ascorbate) 96.76
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 96.75
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 96.72
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 96.69
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 96.64
PRK10996139 thioredoxin 2; Provisional 96.57
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 96.52
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 96.51
PF03960110 ArsC: ArsC family; InterPro: IPR006660 Several bac 96.49
PF13728215 TraF: F plasmid transfer operon protein 96.47
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 96.46
COG0625211 Gst Glutathione S-transferase [Posttranslational m 96.45
cd02955124 SSP411 TRX domain, SSP411 protein family; members 96.45
PLN02395215 glutathione S-transferase 96.41
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 96.41
KOG0406|consensus231 96.4
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 96.38
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 96.36
PRK10877232 protein disulfide isomerase II DsbC; Provisional 96.36
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 96.31
KOG1422|consensus221 96.3
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.23
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 96.19
PRK10357202 putative glutathione S-transferase; Provisional 96.15
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 96.13
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 96.12
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 96.09
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 96.09
TIGR02740271 TraF-like TraF-like protein. This protein is relat 96.08
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 96.0
PTZ00062204 glutaredoxin; Provisional 95.94
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 95.78
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 95.77
PTZ00443224 Thioredoxin domain-containing protein; Provisional 95.73
PRK11752264 putative S-transferase; Provisional 95.7
PRK13728181 conjugal transfer protein TrbB; Provisional 95.67
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 95.67
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA 95.55
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 95.48
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 95.48
TIGR02739256 TraF type-F conjugative transfer system pilin asse 95.45
KOG4023|consensus108 95.44
KOG0907|consensus106 95.35
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 95.24
PRK13703248 conjugal pilus assembly protein TraF; Provisional 95.21
PF06764202 DUF1223: Protein of unknown function (DUF1223); In 95.0
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 94.93
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 94.88
PRK10542201 glutathionine S-transferase; Provisional 94.83
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 94.81
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 94.77
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 94.75
KOG0867|consensus226 94.66
PLN02309457 5'-adenylylsulfate reductase 94.54
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 94.44
KOG4244|consensus281 94.36
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 94.18
COG3634 520 AhpF Alkyl hydroperoxide reductase, large subunit 94.16
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 93.92
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 93.92
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 93.92
PTZ00102 477 disulphide isomerase; Provisional 93.73
PRK00293571 dipZ thiol:disulfide interchange protein precursor 93.48
PTZ00057205 glutathione s-transferase; Provisional 93.25
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 93.23
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 92.98
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 92.72
COG5494265 Predicted thioredoxin/glutaredoxin [Posttranslatio 92.67
KOG0868|consensus217 92.45
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 92.37
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 92.32
PRK03147173 thiol-disulfide oxidoreductase; Provisional 92.02
PTZ00102477 disulphide isomerase; Provisional 91.43
cd02958114 UAS UAS family; UAS is a domain of unknown functio 91.23
KOG2501|consensus157 91.22
KOG3425|consensus128 91.13
cd02967114 mauD Methylamine utilization (mau) D family; mauD 90.95
COG2143182 Thioredoxin-related protein [Posttranslational mod 90.55
COG3019149 Predicted metal-binding protein [General function 90.24
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 90.23
KOG0908|consensus288 89.73
PF06953123 ArsD: Arsenical resistance operon trans-acting rep 89.67
KOG0190|consensus 493 89.43
PF0731593 DUF1462: Protein of unknown function (DUF1462); In 89.26
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 88.47
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 88.36
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 88.28
PF11009105 DUF2847: Protein of unknown function (DUF2847); In 88.21
PHA03075123 glutaredoxin-like protein; Provisional 87.77
KOG1695|consensus206 87.75
COG5429261 Uncharacterized secreted protein [Function unknown 86.96
smart00594122 UAS UAS domain. 86.95
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 86.69
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 86.43
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 86.32
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 83.3
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 81.93
PF1056872 Tom37: Outer mitochondrial membrane transport comp 81.48
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 81.01
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 80.98
>TIGR00598 rad14 DNA repair protein Back     alignment and domain information
Probab=100.00  E-value=1.2e-38  Score=265.79  Aligned_cols=99  Identities=28%  Similarity=0.508  Sum_probs=96.2

Q ss_pred             ccccccchhhhhhhccCCCCCccc----cccccccCCCC-CCCCceeeeHHHHHHHHHHHhCCHHHHHHHHHHhHHHHHH
Q psy1894         108 TERNFITPNRAMSDFLLKQSDLEG----LKVIKRRSPYE-NEPPISVYWRKDVEAKAIQVWGSKERLLQERLKNELERKY  182 (228)
Q Consensus       108 ~~~~lit~t~a~~~y~l~~~dl~~----l~~~~~~nP~~-~~~~m~lyl~~~ve~~a~~~wgs~e~l~~e~~~r~~~~~~  182 (228)
                      .+++|||+|+|++||||+|+||++    |++|.++|||+ +|++|+|||++|||++|++||||+|+|++|+++|++++++
T Consensus        30 ek~~liTkTeak~dYlL~d~dL~~~e~~L~~i~k~NPh~~~~~~MkLYlr~qVe~~A~~~wGS~E~L~~E~e~Re~~k~~  109 (172)
T TIGR00598        30 DKYKLLTKTEAKEEYLLKDCDLDKREPLLRRIVKKNPHNPRWGDMKLYLKLQVEKRALEVWGSEEALDEEKERREESKEE  109 (172)
T ss_pred             cccccccHHHHHHHhcCChhhhhcchhhchhcccCCCCCCCcccceeehHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHH
Confidence            356999999999999999999999    99999999998 9999999999999999999999999999999999999999


Q ss_pred             HHHHhhHHHHHHHHHHHHhcccchhh
Q psy1894         183 QQQHIFTMKRKLRDYRREQGSLADQK  208 (228)
Q Consensus       183 ~~~~~~~~~~~lk~lr~~~~~~~~~~  208 (228)
                      ++|++|+  ++||+||+++|++.|++
T Consensus       110 ~kekkf~--kklkelR~~~R~~~y~~  133 (172)
T TIGR00598       110 MKEKKFE--KKLKELRRAVRSSEYTN  133 (172)
T ss_pred             HHHHHHH--HHHHHHHHHHHHHHhhc
Confidence            9999999  99999999999999975



This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).

>KOG4017|consensus Back     alignment and domain information
>COG5145 RAD14 DNA excision repair protein [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>KOG1752|consensus Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>PF05181 XPA_C: XPA protein C-terminus; InterPro: IPR022656 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>KOG2802|consensus Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>KOG0911|consensus Back     alignment and domain information
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>KOG2824|consensus Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>KOG3029|consensus Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>KOG0910|consensus Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>PRK10853 putative reductase; Provisional Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>KOG0406|consensus Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>KOG1422|consensus Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>KOG4023|consensus Back     alignment and domain information
>KOG0907|consensus Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>PF06764 DUF1223: Protein of unknown function (DUF1223); InterPro: IPR010634 This family consists of several hypothetical proteins of around 250 residues in length, which are found in both plants and bacteria Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>KOG0867|consensus Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>KOG4244|consensus Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>COG5494 Predicted thioredoxin/glutaredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0868|consensus Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>KOG2501|consensus Back     alignment and domain information
>KOG3425|consensus Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3019 Predicted metal-binding protein [General function prediction only] Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>KOG0908|consensus Back     alignment and domain information
>PF06953 ArsD: Arsenical resistance operon trans-acting repressor ArsD; InterPro: IPR010712 This family consists of several bacterial arsenical resistance operon trans-acting repressor ArsD proteins Back     alignment and domain information
>KOG0190|consensus Back     alignment and domain information
>PF07315 DUF1462: Protein of unknown function (DUF1462); InterPro: IPR009190 There are currently no experimental data for members of this group of bacterial proteins or their homologues Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol Back     alignment and domain information
>PHA03075 glutaredoxin-like protein; Provisional Back     alignment and domain information
>KOG1695|consensus Back     alignment and domain information
>COG5429 Uncharacterized secreted protein [Function unknown] Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query228
2enk_A101 Solution Structure Of A Putativ Dna-Binding Domain 2e-17
2ht9_A146 The Structure Of Dimeric Human Glutaredoxin 2 Lengt 2e-10
2fls_A132 Crystal Structure Of Human Glutaredoxin 2 Complexed 2e-10
2cq9_A130 Solution Structure Of Rsgi Ruh-044, An N-Terminal D 2e-10
3h8q_A114 Crystal Structure Of Glutaredoxin Domain Of Human T 1e-09
3ctf_A129 Crystal Structure Of Oxidized Grx2 Length = 129 5e-09
3d4m_A109 Glutaredoxin 2 Oxidized Structure Length = 109 5e-09
3c1r_A118 Crystal Structure Of Oxidized Grx1 Length = 118 2e-08
3h4k_A 598 Crystal Structure Of The Wild Type Thioredoxin Glut 2e-08
2x8c_A 598 Thioredoxin Glutathione Reductase From Schistosoma 3e-08
2v6o_A 596 Structure Of Schistosoma Mansoni Thioredoxin-Glutat 3e-08
3d5j_A112 Structure Of Yeast Grx2-C30s Mutant With Glutathion 8e-08
1z7p_A117 Solution Structure Of Reduced Glutaredoxin C1 From 2e-07
2e7p_A116 Crystal Structure Of The Holo Form Of Glutaredoxin 3e-07
2jac_A110 Glutaredoxin Grx1p C30s Mutant From Yeast Length = 4e-07
2jad_A362 Yellow Fluorescent Protein - Glutaredoxin Fusion Pr 6e-07
3rhb_A113 Crystal Structure Of The Apo Form Of Glutaredoxin C 3e-06
3fz9_A112 Crystal Structure Of Poplar Glutaredoxin S12 In Com 1e-05
1jhb_A106 Human Glutaredoxin In Fully Reduced Form, Nmr, 20 S 2e-05
1b4q_A105 Solution Structure Of Human Thioltransferase Comple 1e-04
1kte_A105 Crystal Structure Of Thioltransferase At 2.2 Angstr 2e-04
2hze_A114 Crystal Structures Of A Poxviral Glutaredoxin In Th 4e-04
>pdb|2ENK|A Chain A, Solution Structure Of A Putativ Dna-Binding Domain Of The Humansolute Carrier Family 30 (Zinc Transporter) Protein Length = 101 Back     alignment and structure

Iteration: 1

Score = 85.5 bits (210), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 45/92 (48%), Positives = 68/92 (73%), Gaps = 2/92 (2%) Query: 108 TERNFITPNRAMSDFLLKQSDLEGLKVIKRRSPYENEPPISVYWRKDVEAKAIQVWGSKE 167 T+ NFIT RA+++F LK SDLE L+ I+RRSP+E+ +VY R DVEAK+++VWGS E Sbjct: 10 TQNNFITGVRAINEFCLKSSDLEQLRKIRRRSPHEDTESFTVYLRSDVEAKSLEVWGSPE 69 Query: 168 RLLQE-RLKNELERKYQQQHIFTMKRKLRDYR 198 L +E +L+ E E +Y+++ +F ++ LR+YR Sbjct: 70 ALAREKKLRKEAEIEYRER-LFRNQKILREYR 100
>pdb|2HT9|A Chain A, The Structure Of Dimeric Human Glutaredoxin 2 Length = 146 Back     alignment and structure
>pdb|2FLS|A Chain A, Crystal Structure Of Human Glutaredoxin 2 Complexed With Glutathione Length = 132 Back     alignment and structure
>pdb|2CQ9|A Chain A, Solution Structure Of Rsgi Ruh-044, An N-Terminal Domain Of Glutaredoxin 2 From Human Cdna Length = 130 Back     alignment and structure
>pdb|3H8Q|A Chain A, Crystal Structure Of Glutaredoxin Domain Of Human Thioredoxin Reductase 3 Length = 114 Back     alignment and structure
>pdb|3CTF|A Chain A, Crystal Structure Of Oxidized Grx2 Length = 129 Back     alignment and structure
>pdb|3D4M|A Chain A, Glutaredoxin 2 Oxidized Structure Length = 109 Back     alignment and structure
>pdb|3C1R|A Chain A, Crystal Structure Of Oxidized Grx1 Length = 118 Back     alignment and structure
>pdb|3H4K|A Chain A, Crystal Structure Of The Wild Type Thioredoxin Glutatione Reductase From Schistosoma Mansoni In Complex With Auranofin Length = 598 Back     alignment and structure
>pdb|2X8C|A Chain A, Thioredoxin Glutathione Reductase From Schistosoma Mansoni With The Reduced C-Terminal End Length = 598 Back     alignment and structure
>pdb|2V6O|A Chain A, Structure Of Schistosoma Mansoni Thioredoxin-Glutathione Reductase (Smtgr) Length = 596 Back     alignment and structure
>pdb|3D5J|A Chain A, Structure Of Yeast Grx2-C30s Mutant With Glutathionyl Mixed Disulfide Length = 112 Back     alignment and structure
>pdb|1Z7P|A Chain A, Solution Structure Of Reduced Glutaredoxin C1 From Populus Tremula X Tremuloides Length = 117 Back     alignment and structure
>pdb|2E7P|A Chain A, Crystal Structure Of The Holo Form Of Glutaredoxin C1 From Populus Tremula X Tremuloides Length = 116 Back     alignment and structure
>pdb|2JAC|A Chain A, Glutaredoxin Grx1p C30s Mutant From Yeast Length = 110 Back     alignment and structure
>pdb|2JAD|A Chain A, Yellow Fluorescent Protein - Glutaredoxin Fusion Protein Length = 362 Back     alignment and structure
>pdb|3RHB|A Chain A, Crystal Structure Of The Apo Form Of Glutaredoxin C5 From Arabidopsis Thaliana Length = 113 Back     alignment and structure
>pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex With Glutathione Length = 112 Back     alignment and structure
>pdb|1JHB|A Chain A, Human Glutaredoxin In Fully Reduced Form, Nmr, 20 Structures Length = 106 Back     alignment and structure
>pdb|1B4Q|A Chain A, Solution Structure Of Human Thioltransferase Complex With Glutathione Length = 105 Back     alignment and structure
>pdb|1KTE|A Chain A, Crystal Structure Of Thioltransferase At 2.2 Angstrom Resolution Length = 105 Back     alignment and structure
>pdb|2HZE|A Chain A, Crystal Structures Of A Poxviral Glutaredoxin In The Oxidized And Reduced States Show Redox-Correlated Structural Changes Length = 114 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query228
2enk_A101 HUEL, solute carrier family 30 member 9; cation tr 8e-29
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 6e-27
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 8e-27
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 2e-26
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 1e-24
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 1e-24
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 2e-24
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 2e-24
1kte_A105 Thioltransferase; redox-active center, electron tr 4e-24
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 1e-23
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 7e-21
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 6e-18
1d4u_A111 Nucleotide excision repair protein XPA (XPA-MBD); 4e-15
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 4e-14
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 2e-13
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 5e-12
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 5e-11
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 9e-11
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 2e-09
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-08
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 3e-07
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 1e-06
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 3e-04
>2enk_A HUEL, solute carrier family 30 member 9; cation transporter, cobalt, zinc, cadmium, protein of unknown function DUF993, embryonic LUNG protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
 Score =  103 bits (258), Expect = 8e-29
 Identities = 42/95 (44%), Positives = 63/95 (66%)

Query: 104 SVSSTERNFITPNRAMSDFLLKQSDLEGLKVIKRRSPYENEPPISVYWRKDVEAKAIQVW 163
           S   T+ NFIT  RA+++F LK SDLE L+ I+RRSP+E+    +VY R DVEAK+++VW
Sbjct: 6   SGKYTQNNFITGVRAINEFCLKSSDLEQLRKIRRRSPHEDTESFTVYLRSDVEAKSLEVW 65

Query: 164 GSKERLLQERLKNELERKYQQQHIFTMKRKLRDYR 198
           GS E L +E+   +      ++ +F  ++ LR+YR
Sbjct: 66  GSPEALAREKKLRKEAEIEYRERLFRNQKILREYR 100


>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} Length = 114 Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 130 Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Length = 146 Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Length = 114 Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Length = 118 Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Length = 113 Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Length = 116 Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Length = 105 Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Length = 129 Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Length = 127 Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 Back     alignment and structure
>1d4u_A Nucleotide excision repair protein XPA (XPA-MBD); DNA repair, loop-rich domain, relaxation, DNA binding protein; NMR {Homo sapiens} SCOP: a.6.1.2 g.39.1.5 PDB: 1xpa_A Length = 111 Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Length = 362 Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} Length = 99 Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Length = 92 Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Length = 89 Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Length = 82 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Length = 103 Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Length = 85 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Length = 92 Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Length = 89 Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Length = 81 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query228
2enk_A101 HUEL, solute carrier family 30 member 9; cation tr 100.0
1d4u_A111 Nucleotide excision repair protein XPA (XPA-MBD); 99.96
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 99.89
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 99.88
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 99.88
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 99.87
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 99.87
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 99.86
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 99.85
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 99.84
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 99.83
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 99.82
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 99.82
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 99.81
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 99.8
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 99.79
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 99.78
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 99.76
1kte_A105 Thioltransferase; redox-active center, electron tr 99.76
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 99.74
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 99.73
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 99.73
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 99.73
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 99.72
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 99.72
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 99.71
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 99.71
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 99.65
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.63
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 99.59
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 99.59
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 99.57
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 99.57
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 99.55
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 99.55
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 99.53
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 99.48
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 99.47
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 99.29
1ttz_A87 Conserved hypothetical protein; structural genomic 99.28
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 99.22
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 99.22
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 98.96
2axo_A270 Hypothetical protein ATU2684; alpha beta protein., 98.93
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 98.91
1z3e_A132 Regulatory protein SPX; bacterial transcription re 98.91
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 98.61
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 98.53
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 98.52
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 98.51
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 98.51
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 98.5
3rdw_A121 Putative arsenate reductase; structural genomics, 98.49
3gkx_A120 Putative ARSC family related protein; ARSC family 98.48
3l78_A120 Regulatory protein SPX; transcription, transcripti 98.47
3fz4_A120 Putative arsenate reductase; APC61768, structural 98.37
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 98.37
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 98.35
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 98.28
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 98.24
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 98.2
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 98.19
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 98.14
2r4v_A247 XAP121, chloride intracellular channel protein 2; 98.13
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 98.11
2ahe_A267 Chloride intracellular channel protein 4; glutathi 98.1
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 98.09
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 98.07
1zma_A118 Bacterocin transport accessory protein; alpha-beta 98.06
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 98.05
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 98.02
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 98.02
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 98.01
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 98.01
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 98.0
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 97.99
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 97.99
1axd_A209 Glutathione S-transferase I; transferase, herbicid 97.99
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 97.98
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 97.98
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 97.97
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 97.97
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 97.96
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 97.96
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 97.96
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 97.96
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 97.95
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 97.95
3lyp_A215 Stringent starvation protein A; structural genomic 97.95
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 97.94
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 97.93
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 97.93
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 97.93
3lyk_A216 Stringent starvation protein A homolog; structural 97.92
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 97.92
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 97.92
2yzu_A109 Thioredoxin; redox protein, electron transport, st 97.92
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 97.92
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 97.91
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 97.91
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 97.9
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 97.9
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 97.9
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 97.9
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 97.9
3lxz_A229 Glutathione S-transferase family protein; structur 97.9
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 97.89
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 97.89
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 97.89
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 97.88
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 97.88
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 97.88
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 97.88
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 97.88
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 97.88
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 97.87
4glt_A225 Glutathione S-transferase-like protein; structural 97.87
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 97.87
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 97.86
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 97.86
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 97.85
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 97.85
1r5a_A218 Glutathione transferase; glutathione S-transferase 97.85
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 97.85
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 97.84
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 97.83
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 97.83
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 97.83
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 97.83
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 97.82
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 97.81
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 97.81
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 97.81
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 97.81
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 97.81
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 97.81
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 97.8
3niv_A222 Glutathione S-transferase; structural genomics, PS 97.8
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 97.79
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 97.79
2l57_A126 Uncharacterized protein; structural genomics, unkn 97.79
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 97.79
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 97.78
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 97.78
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 97.77
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 97.77
3n5o_A235 Glutathione transferase; seattle structural genomi 97.77
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 97.76
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 97.76
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 97.76
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 97.76
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 97.76
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 97.74
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 97.74
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 97.74
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 97.73
4dej_A231 Glutathione S-transferase related protein; transfe 97.72
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 97.72
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 97.72
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 97.71
4euy_A105 Uncharacterized protein; structural genomics, PSI- 97.7
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 97.7
3tou_A226 Glutathione S-transferase protein; GSH binding sit 97.69
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 97.68
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 97.68
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 97.68
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 97.67
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 97.66
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 97.64
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 97.64
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 97.63
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 97.63
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 97.62
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 97.6
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 97.6
1wmj_A130 Thioredoxin H-type; structural genomics, program f 97.59
2l5l_A136 Thioredoxin; structural genomics, electron transpo 97.57
1mek_A120 Protein disulfide isomerase; electron transport, r 97.57
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 97.56
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 97.55
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 97.55
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 97.55
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 97.54
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 97.52
4exj_A238 Uncharacterized protein; transferase-like protein, 97.5
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 97.48
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 97.48
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 97.47
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 97.44
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 97.44
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 97.43
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 97.42
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 97.42
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 97.42
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 96.54
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 97.41
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 97.4
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 97.39
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 97.39
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 97.38
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 97.36
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 97.36
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 97.35
4ikh_A244 Glutathione S-transferase; enzyme function initiat 97.34
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 97.33
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 97.32
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 97.31
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 97.29
2kuc_A130 Putative disulphide-isomerase; structural genomics 97.27
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 97.27
4ecj_A244 Glutathione S-transferase; transferase-like protei 97.26
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 97.24
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 97.23
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 97.21
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 97.21
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 97.17
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 97.15
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 97.15
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 97.13
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 97.11
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 97.1
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 97.09
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 97.09
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 96.16
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 97.04
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 97.03
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 97.02
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 97.02
2fhe_A216 GST, glutathione S-transferase; transferase-substr 97.01
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 97.01
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 97.0
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 96.96
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 96.95
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 96.92
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 96.89
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 96.88
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 96.87
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 96.87
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 96.86
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 96.84
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 96.83
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 96.79
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 96.78
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 96.76
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 96.75
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 96.75
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 96.67
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 96.66
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 96.62
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 96.6
1f2e_A201 Glutathione S-transferase; GST complexed with glut 96.58
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 96.57
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 96.55
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 96.46
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 96.45
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 96.44
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 96.44
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 96.36
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoe 96.35
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 96.34
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 96.33
1z6m_A175 Conserved hypothetical protein; structural genomic 96.32
2lrn_A152 Thiol:disulfide interchange protein; structural ge 96.24
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 96.24
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 96.21
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 96.2
2qsi_A137 Putative hydrogenase expression/formation protein; 96.2
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 96.19
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 96.18
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 96.17
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 96.17
3f9u_A172 Putative exported cytochrome C biogenesis-related; 96.11
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 96.11
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 96.08
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 96.04
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 96.03
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 96.0
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 96.0
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 95.98
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 95.97
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 95.96
4gci_A211 Glutathione S-transferase; GST, enzyme function in 95.92
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 95.91
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 95.89
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 95.88
3hd5_A195 Thiol:disulfide interchange protein DSBA; protein 95.88
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 95.87
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 95.85
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 95.83
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 95.82
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 95.82
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 95.8
4evm_A138 Thioredoxin family protein; structural genomics, n 95.73
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 95.73
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 95.71
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 95.69
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 95.64
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 95.62
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase 95.51
2lrt_A152 Uncharacterized protein; structural genomics, thio 95.47
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 95.41
2l5o_A153 Putative thioredoxin; structural genomics, unknown 95.4
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 95.35
3raz_A151 Thioredoxin-related protein; structural genomics, 95.15
3ira_A173 Conserved protein; methanosarcina mazei,structural 95.13
3h93_A192 Thiol:disulfide interchange protein DSBA; disulfid 94.93
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 94.93
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 94.78
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 93.47
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 94.41
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 94.37
1sji_A350 Calsequestrin 2, calsequestrin, cardiac muscle iso 94.15
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 94.08
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 93.97
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 93.95
2ywi_A196 Hypothetical conserved protein; uncharacterized co 93.94
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 93.91
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 93.9
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredo 93.69
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 93.57
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 93.37
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 93.26
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 93.2
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 92.99
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 92.9
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 92.65
3ktb_A106 Arsenical resistance operon trans-acting represso; 92.63
2ls5_A159 Uncharacterized protein; structural genomics, unkn 91.57
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 92.24
3kgk_A110 Arsenical resistance operon trans-acting represso; 92.04
1xg8_A111 Hypothetical protein SA0798; structural genomics, 91.9
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 91.64
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 91.26
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 90.24
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 90.14
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 89.26
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 88.54
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 88.39
2g2q_A124 Glutaredoxin-2; thioredoxin-fold, oxidoreductase, 88.08
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 87.77
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 87.19
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 86.56
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 86.39
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 86.35
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 85.62
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 85.4
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 85.3
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 85.27
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 85.2
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 85.16
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 84.82
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 84.06
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 83.62
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 83.6
3tdg_A273 DSBG, putative uncharacterized protein; thioredoxi 83.6
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-ox 83.55
2hyx_A352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 83.48
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 82.76
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 82.61
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 81.63
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 80.68
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 80.44
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 80.36
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 80.34
>2enk_A HUEL, solute carrier family 30 member 9; cation transporter, cobalt, zinc, cadmium, protein of unknown function DUF993, embryonic LUNG protein; NMR {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=5.8e-38  Score=240.64  Aligned_cols=97  Identities=43%  Similarity=0.662  Sum_probs=92.5

Q ss_pred             cCCcCcccccccchhhhhhhccCCCCCccccccccccCCCCCCCCceeeeHHHHHHHHHHHhCCHHHHHHHHHHhHHHHH
Q psy1894         102 DLSVSSTERNFITPNRAMSDFLLKQSDLEGLKVIKRRSPYENEPPISVYWRKDVEAKAIQVWGSKERLLQERLKNELERK  181 (228)
Q Consensus       102 ~~~~~~~~~~lit~t~a~~~y~l~~~dl~~l~~~~~~nP~~~~~~m~lyl~~~ve~~a~~~wgs~e~l~~e~~~r~~~~~  181 (228)
                      -|++++.+|+|||+|+|++||||+|+||++|+||.++|||+.+++|+|||++|||++|++||||+|+|++|+++|+++++
T Consensus         4 ~~~~~~~~~~lITkteAk~dYlLkd~dL~~L~~i~k~NPh~~~~~MkLYlr~qVe~rAlevWGS~E~Le~E~e~R~~~r~   83 (101)
T 2enk_A            4 GSSGKYTQNNFITGVRAINEFCLKSSDLEQLRKIRRRSPHEDTESFTVYLRSDVEAKSLEVWGSPEALAREKKLRKEAEI   83 (101)
T ss_dssp             CCCCSCCCCSEEEHHHHHHHTCCCHHHHHHSCCBCTTCSSCSSCCCCEEEHHHHHHHHHHHSSSHHHHHHHHHHHHHHHH
T ss_pred             CcCCCccccccccHHHHHHHHCCChhhhhhCcccccCCCCCCCCCceeehHHHHHHHHHHHHCCHHHHHHHHHHHHHHHH
Confidence            37788889999999999999999999999999999999998559999999999999999999999999999999999999


Q ss_pred             HHHHHhhHHHHHHHHHH
Q psy1894         182 YQQQHIFTMKRKLRDYR  198 (228)
Q Consensus       182 ~~~~~~~~~~~~lk~lr  198 (228)
                      +++|++|++++.|+++|
T Consensus        84 ~~~~k~f~~k~~l~~y~  100 (101)
T 2enk_A           84 EYRERLFRNQKILREYR  100 (101)
T ss_dssp             HHHHHHHHHHCSSCCSC
T ss_pred             HHHHHHHHHHHHHHHhc
Confidence            99999999999888876



>1d4u_A Nucleotide excision repair protein XPA (XPA-MBD); DNA repair, loop-rich domain, relaxation, DNA binding protein; NMR {Homo sapiens} SCOP: a.6.1.2 g.39.1.5 PDB: 1xpa_A Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ktb_A Arsenical resistance operon trans-acting represso; alpha-beta-alpha sandwich, helix-turn-helix, structural GENO PSI-2; 2.10A {Bacteroides vulgatus} Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3kgk_A Arsenical resistance operon trans-acting represso; alpha+beta, chaperone, DNA-binding, RE transcription, transcription regulation; 1.40A {Escherichia coli} PDB: 3mwh_A Back     alignment and structure
>1xg8_A Hypothetical protein SA0798; structural genomics, protein structure initative, MCSG, PSI, protein structure initiative; 2.10A {Staphylococcus aureus subsp} SCOP: c.47.1.17 Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>2g2q_A Glutaredoxin-2; thioredoxin-fold, oxidoreductase, poxvirus; 2.50A {Vaccinia virus} Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori} Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 228
d1d4ua175 a.6.1.2 (A:37-111) DNA repair factor XPA DNA- and 4e-17
d1ktea_105 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 2e-11
d1egoa_85 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 5e-09
d1nm3a174 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hyb 6e-09
d1fova_82 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 1e-06
d1r7ha_74 c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Cory 1e-06
d1wika_109 c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (M 9e-06
d1h75a_76 c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Esch 2e-05
d1abaa_87 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 3e-04
>d1d4ua1 a.6.1.2 (A:37-111) DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure

class: All alpha proteins
fold: Putative DNA-binding domain
superfamily: Putative DNA-binding domain
family: DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain
domain: DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 71.3 bits (175), Expect = 4e-17
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 5/72 (6%)

Query: 111 NFITPNRAMSDFLLKQSDLEG----LKVIKRRSPYE-NEPPISVYWRKDVEAKAIQVWGS 165
             IT   A  ++LLK  DLE     LK I +++P+      + +Y +  +  ++++VWGS
Sbjct: 4   KLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGS 63

Query: 166 KERLLQERLKNE 177
           +E L + +   +
Sbjct: 64  QEALEEAKEVRQ 75


>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 105 Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Length = 85 Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Length = 74 Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Length = 82 Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Length = 74 Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Length = 87 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query228
d1d4ua175 DNA repair factor XPA DNA- and RPA-binding domain, 100.0
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 99.87
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 99.85
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 99.85
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 99.84
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 99.76
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 99.75
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 99.73
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 99.7
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 99.64
d1wjka_100 Thioredoxin-like structure containing protein C330 99.08
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 99.07
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 98.91
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 98.89
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 98.58
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 98.55
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 98.53
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 98.5
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 98.5
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 98.49
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 98.45
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 98.44
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 98.43
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 98.4
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 98.4
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 98.36
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 98.35
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 98.34
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 98.32
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 98.24
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 98.19
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 98.12
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 98.09
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 98.02
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 98.0
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 98.0
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 97.96
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 97.83
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 97.8
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 97.75
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.72
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.69
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 97.68
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 97.68
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 97.63
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.59
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 97.58
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 97.45
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 97.44
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.43
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 97.42
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 97.4
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 97.4
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 97.38
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 97.15
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 97.01
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 96.92
d1j9ba_138 Arsenate reductase ArsC {Escherichia coli [TaxId: 96.88
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 96.87
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 96.86
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 96.83
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 96.68
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 96.67
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 96.66
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 96.65
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 96.64
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 96.6
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 96.59
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 96.58
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 96.57
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 96.47
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 96.34
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 96.23
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 95.92
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 95.7
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 95.66
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 95.57
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 95.55
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 95.25
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 95.2
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 94.94
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 94.65
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 94.63
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 94.55
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 94.5
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 94.25
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 93.62
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 93.59
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 93.53
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 93.23
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 93.01
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 92.85
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 92.73
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 92.52
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 92.41
d2axoa1225 Hypothetical protein Atu2684 {Agrobacterium tumefa 92.41
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 92.13
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 91.45
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 90.67
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 89.78
d1xg8a_111 Hypothetical protein SA0798 {Staphylococcus aureus 89.26
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 86.21
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 84.5
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 84.04
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 83.51
>d1d4ua1 a.6.1.2 (A:37-111) DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Putative DNA-binding domain
superfamily: Putative DNA-binding domain
family: DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain
domain: DNA repair factor XPA DNA- and RPA-binding domain, C-terminal subdomain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.9e-34  Score=207.95  Aligned_cols=69  Identities=29%  Similarity=0.560  Sum_probs=66.4

Q ss_pred             cccccchhhhhhhccCCCCCccc----cccccccCCCC-CCCCceeeeHHHHHHHHHHHhCCHHHHHHHHHHhH
Q psy1894         109 ERNFITPNRAMSDFLLKQSDLEG----LKVIKRRSPYE-NEPPISVYWRKDVEAKAIQVWGSKERLLQERLKNE  177 (228)
Q Consensus       109 ~~~lit~t~a~~~y~l~~~dl~~----l~~~~~~nP~~-~~~~m~lyl~~~ve~~a~~~wgs~e~l~~e~~~r~  177 (228)
                      +|+|||+|+|++||||+|+||++    |+||.++|||+ +|++|+|||++|||++|++||||+|+|++|+++|+
T Consensus         2 k~~liTkTeak~dYlL~d~dL~~~e~~L~~i~k~NPh~~~~~~MkLYlr~qVE~~A~e~WGs~E~L~~E~~~Re   75 (75)
T d1d4ua1           2 KHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQ   75 (75)
T ss_dssp             SCCCEEHHHHTTTTTCCSSSTTTSCCSCCEEESSCSSSCCCSCCEEECHHHHHHHHHHHTSSHHHHHHHHHHCC
T ss_pred             ccchhhHHHHHHHhcCCchhhccccccccccccCCCCCCCCCCceeeehHHHHHHHHHHHCCHHHHHHHHHhcC
Confidence            46999999999999999999997    99999999998 89999999999999999999999999999999884



>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xg8a_ c.47.1.17 (A:) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure