Diaphorina citri psyllid: psy1909


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MQHKDVLDKQSRPRDRKEDISLGLKSTAILFGDKTKLYLSGFGGVMMSSLVTCGILSGQTWPYFLSLSLIGSHLASQIYHLDIVFLGLQFYC
ccccHHHHHHHcccccHHHHHcccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
MQHKDVLDKQSRPRDRKEDISLGLKSTAILFGDKTKLYLSGFGGVMMSSLVTCGILSGQTWPYFLSLSLIGSHLASQIYHLDIVFLGLQFYC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQHKDVLDKQSRPRDRKEDISLGLKSTAILFGDKTKLYLSGFGGVMMSSLVTCGILSGQTWPYFLSLSLIGSHLASQIYHLDIVFLGLQFYC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
4-hydroxybenzoate polyprenyltransferase, mitochondrial Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.confidentQ499N4
4-hydroxybenzoate polyprenyltransferase, mitochondrial Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.confidentQ2KIQ4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted