Diaphorina citri psyllid: psy1910


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MRLDKPIGSWLLFWPCGWSISMAAVPGCLPDLHTLALFGLGAVIMRGAGCTINDLWDKDIDSKVSRTKDRPLVNGSISTTDAIIFLAGQLGAGLLILVQLNLYTIILGSTSLLFVTLYPLMKRVTHWAQLTLGMTFNYGALMGYSAVTGCVNE
ccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHccccc
MRLDKPIGSWLLFWPCGWSISMAAVPGCLPDLHTLALFGLGAVIMRGAGCTINDLWDKDIDSKVSRTKDRPLVNGSISTTDAIIFLAGQLGAGLLILVQLNLYTIILGSTSLLFVTLYPLMKRVTHWAQLTLGMTFNYGALMGYSAVTGC***
xxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLDKPIGSWLLFWPCGWSISMAAVPGCLPDLHTLALFGLGAVIMRGAGCTINDLWDKDIDSKVSRTKDRPLVNGSISTTDAIIFLAGQLGAGLLILVQLNLYTIILGSTSLLFVTLYPLMKRVTHWAQLTLGMTFNYGALMGYSAVTGCVNE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
4-hydroxybenzoate polyprenyltransferase, mitochondrial Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.confidentQ8I7J4
4-hydroxybenzoate polyprenyltransferase, mitochondrial Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.confidentQ2KIQ4
4-hydroxybenzoate polyprenyltransferase, mitochondrial Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.confidentQ54U71

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004659 [MF]prenyltransferase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048009 [BP]insulin-like growth factor receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted