Diaphorina citri psyllid: psy1912


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MTFNYGALMGYSAVTGCVDWSLCLPLYLSGICWTIIYDTIYAHQVRIHLIDLCENGVNFISKSITNIDNVNRGLPYQ
cCEEHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHccccccc
MTFNYGALMGYSAVTGCVDWSLCLPLYLSGICWTIIYDTIYAHQVRIHLIDLCENGVNFISKSITNIDNVNRGLPYQ
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTFNYGALMGYSAVTGCVDWSLCLPLYLSGICWTIIYDTIYAHQVRIHLIDLCENGVNFISKSITNIDNVNRGLPYQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
4-hydroxybenzoate polyprenyltransferase, mitochondrial Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.confidentQ2KIQ4
4-hydroxybenzoate polyprenyltransferase, mitochondrial Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.confidentP32378
4-hydroxybenzoate polyprenyltransferase, mitochondrial Catalyzes the prenylation of para-hydroxybenzoate (PHB) with an all-trans polyprenyl group. Mediates the second step in the final reaction sequence of coenzyme Q (CoQ) biosynthesis, which is the condensation of the polyisoprenoid side chain with PHB.confidentQ499N4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004659 [MF]prenyltransferase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0006071 [BP]glycerol metabolic processprobableGO:0044238, GO:0044710, GO:0044262, GO:0008150, GO:0009987, GO:0019751, GO:0044237, GO:0006066, GO:0071704, GO:0019400, GO:0044281, GO:0008152, GO:0005975, GO:1901615
GO:0006744 [BP]ubiquinone biosynthetic processprobableGO:0006732, GO:0006733, GO:0044249, GO:0009108, GO:0044281, GO:0044283, GO:0045426, GO:1901576, GO:0044710, GO:0051186, GO:1901663, GO:0051188, GO:1901661, GO:0042375, GO:0071704, GO:0006743, GO:0009987, GO:0009058, GO:0044711, GO:0008150, GO:0008152, GO:0042181, GO:0042180, GO:0044237
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0048009 [BP]insulin-like growth factor receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699
GO:0032592 [CC]integral to mitochondrial membraneprobableGO:0031975, GO:0043229, GO:0031301, GO:0031300, GO:0043227, GO:0043226, GO:0031224, GO:0005737, GO:0005575, GO:0031090, GO:0016021, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044425, GO:0044422
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted