Diaphorina citri psyllid: psy1914


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
FLFFKFRKSSQKVVLLSGLSLSGKTLLFARLVYSKYFESCTSLKENVGNFTYEKKNIKIVDLPGEDRLRNKFFDQYKSSAKGIVYVLDSSTVQKTLRDVAESLYVILADPQVQSSRVNILVCCNKQDQTLAKSSSVVKTLLQKELNLVRRTKSNQLEDTNDVAANQTFLGNPDKDFEFSDLYNQVSFCDTTGLDSASEYDVEQLQDWMVTL
ccccccccccccEEEEEccccccHHHHHHHHHcccccEEEEcccccCEEEEEcccEEEEEEccccHHHHHHHHHHHHHcccEEEEEEEcccccccHHHHHHHHHHHHccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHccccccEECccccccccccccccccccEEcccccCEEEEEEccccccccccHHHHHHHHHHc
FLF*****SSQKVVLLSGLSLSGKTLLFARLVYSKYFESCTSLKENVGNFTYEKKNIKIVDLPGEDRLRNKFFDQYKSSAKGIVYVLDSSTVQKTLRDVAESLYVILADPQVQSSRVNILVCCNKQDQTLAKSSSVVKTLLQKELNLVRRTKSNQLEDTNDVAANQTFLGNPDKDFEFSDLYNQVSFCDTTGLDSASEYDVEQLQDWMVTL
xxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FLFFKFRKSSQKVVLLSGLSLSGKTLLFARLVYSKYFESCTSLKENVGNFTYEKKNIKIVDLPGEDRLRNKFFDQYKSSAKGIVYVLDSSTVQKTLRDVAESLYVILADPQVQSSRVNILVCCNKQDQTLAKSSSVVKTLLQKELNLVRRTKSNQLEDTNDVAANQTFLGNPDKDFEFSDLYNQVSFCDTTGLDSASEYDVEQLQDWMVTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal recognition particle receptor subunit beta Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system. Has GTPase activity. May mediate the membrane association of SRPR.confidentQ4FZX7
Signal recognition particle receptor subunit beta Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system. Has GTPase activity. May mediate the membrane association of SRPR.confidentQ54XX1
Signal recognition particle receptor subunit beta Component of the SRP (signal recognition particle) receptor. Ensures, in conjunction with the signal recognition particle, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system. Has GTPase activity. May mediate the membrane association of SRPR.confidentP36057

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044425 [CC]membrane partprobableGO:0005575, GO:0016020
GO:0005488 [MF]bindingprobableGO:0003674
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006810 [BP]transportprobableGO:0051234, GO:0008150, GO:0051179
GO:0005881 [CC]cytoplasmic microtubuleprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FH5, chain B
Confidence level:very confident
Coverage over the Query: 12-153,166-210
View the alignment between query and template
View the model in PyMOL