Diaphorina citri psyllid: psy1930


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MKLKRRKERENKKKKKKKKKKKKKKKKKKKKKKKRVLYHMFEAYTEMGHNNVLYVDLLSGLASFFVVAVGGTVIGVIWGFLTGFVTRFTNEVRVIEPIFIFVMAYLAYLTAEIFHMSGILAITFCGITMKNYVEANISHKSHTTVKYAMKMLSSSSETIIFMFLGISTISDAHVWNTAFVILTIFFCSLYRTLGK
cccHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcc
****************************KKKKKKRVLYHMFEAYTEMGHNNVLYVDLLSGLASFFVVAVGGTVIGVIWGFLTGFVTRFTNEVRVIEPIFIFVMAYLAYLTAEIFHMSGILAITFCGITMKNYVEANISHKSHTTVKYAMKMLSSSSETIIFMFLGISTISDAHVWNTAFVILTIFFCSLYRTLGK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHxxxxxxxxxxHHHxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxx
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVLYHMFEAYTEMGHNNVLYVDLLSGLASFFVVAVGGTVIGVIWGFLTGFVTRFTNEVRVIEPIFIFVMAYLAYLTAEIFHMSGILAITFCGITMKNYVEANISHKSHTTVKYAMKMLSSSSETIIFMFLGISTISDAHVWNTAFVILTIFFCSLYRTLGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sodium/hydrogen exchanger 2 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Seems to play an important role in colonic sodium absorption.confidentP48763
Sodium/hydrogen exchanger 3 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Plays an important role in signal transduction.confidentP26432
Sodium/hydrogen exchanger 2 Involved in pH regulation to eliminate acids generated by active metabolism or to counter adverse environmental conditions. Major proton extruding system driven by the inward sodium ion chemical gradient. Seems to play an important role in colonic sodium absorption.confidentP50482

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2K3C, chain A
Confidence level:probable
Coverage over the Query: 103-133
View the alignment between query and template
View the model in PyMOL
Template: 1ZCD, chain A
Confidence level:probable
Coverage over the Query: 104-170
View the alignment between query and template
View the model in PyMOL