Diaphorina citri psyllid: psy194


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-----
MWKAAAGSGVAPVVANQDDDDWETDPDFINDVSEQEQRWGSKTIPGSGRTGGTIDMKQLREEVAISDACYKQKQLEEGSKASYGYGGKFGVEKDRMDESAVGHDYVAQLHQHESQSDYKTGFGGKFGVQNDRVDKSAVTWDHKEVIEKHASQKDYSSGFGGKFGVQKDRQDKSAVGWDHQEKIEKHESQKDYAKGFGGKFGIESDRQDKSAVGWDHVEKVDKHQSQKDDNRQVVTSSKVKDLIAANSTNASKENIKPKPNIGHVKPSNLRAKFENLAKQTEEESRKRSEEEKEKRKLKDQIDLEQAQKLEERRLSELKIKEEEIEKKLNGHSDVPLSPSTETPPVPVKSILKQPTSDGIPIQNSNKEEEEKEKQRMVQEEIKRKELERKEELEKEQIRIKEEQENIKKKKEQEEKERKEQEENQKLLLKKQQEEDRLKAEEQARLLEQERLMEELRQQGTNEDTEEDLGYTAVALYDYQASADDEISFDPDDIITNIEMIDEGWWRGYCHGQYGLFPANYVSLQQ
cccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEccccccccccccccccccEEEEccccccccEEEEccccccccccccEEEcc
*******************DDWETDPDFINDVSEQE******************DMKQLR***AISDACY****************GKFGVEKDRMD********V*************TGFGGKFGVQNDRVDKSAVTWD****************GFGGKFGVQKDR*****************************************************************************************************************************************************************************************************************************************************************************************************DTEEDLGYTAVALYDYQASADDEISFDPDDIITNIEMIDEGWWRGYCHGQYGLFPANYVSLQQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWKAAAGSGVAPVVANQDDDDWETDPDFINDVSEQEQRWGSKTIPGSGRTGGTIDMKQLREEVAISDACYKQKQLEEGSKASYGYGGKFGVEKDRMDESAVGHDYVAQLHQHESQSDYKTGFGGKFGVQNDRVDKSAVTWDHKEVIEKHASQKDYSSGFGGKFGVQKDRQDKSAVGWDHQEKIEKHESQKDYAKGFGGKFGIESDRQDKSAVGWDHVEKVDKHQSQKDDNRQVVTSSKVKDLIAANSTNASKENIKPKPNIGHVKPSNLRAKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLNGHSDVPLSPSTETPPVPVKSILKQPTSDGIPIQNSNKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGTNEDTEEDLGYTAVALYDYQASADDEISFDPDDIITNIEMIDEGWWRGYCHGQYGLFPANYVSLQQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Src substrate protein p85 Contributes to the organization of the actin cytoskeleton and cell structure. Plays a role in the regulation of cell migration.confidentQ01406
Src substrate cortactin Contributes to the organization of the actin cytoskeleton and cell structure. Plays a role in the regulation of cell migration. Plays a role in the invasiveness of cancer cells, and the formation of metastases.confidentQ60598

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071345 [BP]cellular response to cytokine stimulusprobableGO:0051716, GO:0034097, GO:0050896, GO:0009987, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0001085 [MF]RNA polymerase II transcription factor bindingprobableGO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0001726 [CC]ruffleprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0070064 [MF]proline-rich region bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0002763 [BP]positive regulation of myeloid leukocyte differentiationprobableGO:0002761, GO:0045597, GO:0051094, GO:0050793, GO:0065007, GO:0045595, GO:0050794, GO:1902107, GO:0050789, GO:1902105, GO:0045639, GO:0002682, GO:0008150, GO:0051239, GO:0048518, GO:2000026, GO:0045637, GO:0048522
GO:0042993 [BP]positive regulation of transcription factor import into nucleusprobableGO:0033157, GO:0032388, GO:0060341, GO:0051049, GO:0032386, GO:0051222, GO:0051223, GO:0050789, GO:0032880, GO:0065007, GO:0048518, GO:0070201, GO:0051050, GO:0090316, GO:0050794, GO:0008150, GO:0042307, GO:0042306, GO:0032879, GO:0042990, GO:1900180, GO:0046824, GO:0046822
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0014068 [BP]positive regulation of phosphatidylinositol 3-kinase cascadeprobableGO:0010646, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0014066, GO:0050789, GO:0048522
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0033138 [BP]positive regulation of peptidyl-serine phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0033135, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0001932, GO:0001934, GO:0048522
GO:2000107 [BP]negative regulation of leukocyte apoptotic processprobableGO:0043069, GO:2000106, GO:0050794, GO:0008150, GO:0043067, GO:0043066, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0050731 [BP]positive regulation of peptidyl-tyrosine phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0050730, GO:0031401, GO:0001932, GO:0001934, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005938 [CC]cell cortexprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0044424
GO:0030833 [BP]regulation of actin filament polymerizationprobableGO:0033043, GO:0051128, GO:0008064, GO:0050789, GO:0044699, GO:0030832, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0071840, GO:0065008, GO:0032271, GO:0032970, GO:0009987, GO:0050794, GO:0044763, GO:0032956, GO:0043254, GO:0044087, GO:0008150, GO:0032535
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0051897 [BP]positive regulation of protein kinase B signaling cascadeprobableGO:0023051, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0050789, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0010627, GO:0051896, GO:0048522
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0070864 [CC]sperm individualization complexprobableGO:0005575, GO:0044464, GO:0032991, GO:0005623
GO:0009725 [BP]response to hormone stimulusprobableGO:0009719, GO:0042221, GO:0050896, GO:0008150, GO:0010033

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X69, chain A
Confidence level:very confident
Coverage over the Query: 467-525
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 348-415
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 348-415
View the alignment between query and template
View the model in PyMOL