Diaphorina citri psyllid: psy1961


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MSEIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDSTPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGTNDKAGGPHYVLRWATPQSIKETFVPLTEWKYPYMG
ccEEEEcccccccccEEEccEEEEEcccccccccccccccEEEEEEEccccHHHHHHHHcccccccccEEEEcccHHHHHHHHHHHHcccccEEEcccccccccccccccccccccccHHHHHHHcccccccccccccccccccccc
MSEIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDSTPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGTNDKAGGPHYVLRWATPQSIKETFVPLTEWKYPYMG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDSTPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGTNDKAGGPHYVLRWATPQSIKETFVPLTEWKYPYMG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial Irreversible conversion of delta-1-pyrroline-5-carboxylate (P5C), derived either from proline or ornithine, to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes.confidentP0C2X9
Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial Irreversible conversion of delta-1-pyrroline-5-carboxylate (P5C), derived either from proline or ornithine, to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes.confidentQ8CHT0
Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial Irreversible conversion of delta-1-pyrroline-5-carboxylate (P5C), derived either from proline or ornithine, to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles.confidentQ7SY23

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004028 [MF]3-chloroallyl aldehyde dehydrogenase activityprobableGO:0003824, GO:0016903, GO:0003674, GO:0016620, GO:0016491
GO:0004029 [MF]aldehyde dehydrogenase (NAD) activityprobableGO:0003824, GO:0016903, GO:0003674, GO:0016620, GO:0016491
GO:0003842 [MF]1-pyrroline-5-carboxylate dehydrogenase activityprobableGO:0003824, GO:0003674, GO:0016646, GO:0016645, GO:0016491
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:1901565 [BP]organonitrogen compound catabolic processprobableGO:1901575, GO:1901564, GO:0071704, GO:0006807, GO:0008150, GO:0008152, GO:0009056
GO:0046394 [BP]carboxylic acid biosynthetic processprobableGO:1901576, GO:0044710, GO:0044711, GO:0006082, GO:0044249, GO:0044237, GO:0009987, GO:0016053, GO:0019752, GO:0071704, GO:0009058, GO:0008150, GO:0044281, GO:0008152, GO:0044283, GO:0043436
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:1901700 [BP]response to oxygen-containing compoundprobableGO:0042221, GO:0050896, GO:0008150
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042905 [BP]9-cis-retinoic acid metabolic processprobableGO:0019752, GO:0044281, GO:0042573, GO:0001523, GO:0042445, GO:0044710, GO:0071704, GO:0065007, GO:0016101, GO:0065008, GO:0006629, GO:0006721, GO:0006720, GO:0009987, GO:0010817, GO:0008150, GO:0008152, GO:0043436, GO:0044255, GO:0032787, GO:0034754, GO:0044238, GO:0006082, GO:0044237
GO:0009064 [BP]glutamine family amino acid metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:0044237, GO:0006520, GO:0019752, GO:0071704, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0043436, GO:1901605
GO:1901361 [BP]organic cyclic compound catabolic processprobableGO:1901575, GO:0071704, GO:0008150, GO:0008152, GO:0009056, GO:1901360
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0046700 [BP]heterocycle catabolic processprobableGO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056, GO:0046483
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0051287 [MF]NAD bindingprobableGO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:1901363, GO:1901265
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0043168 [MF]anion bindingprobableGO:0003674, GO:0005488, GO:0043167
GO:0034641 [BP]cellular nitrogen compound metabolic processprobableGO:0009987, GO:0006807, GO:0008150, GO:0008152, GO:0044237
GO:0006081 [BP]cellular aldehyde metabolic processprobableGO:0044710, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4E3X, chain A
Confidence level:very confident
Coverage over the Query: 2-146
View the alignment between query and template
View the model in PyMOL