Psyllid ID: psy1961


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MSEIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDSTPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGTNDKAGGPHYVLRWATPQSIKETFVPLTEWKYPYMG
ccEEEEcccccccccEEEccEEEEEcccccccccccccccEEEEEEEccccHHHHHHHHHccccccccEEEEcccHHHHHHHHHHHHcccccEEEcccccccccccccccccccccccHHHHHHHHccccccccccccccccccccc
ccEEEEEcccccccEEEEccEEEEEcccccccHHHHHcccEEEEEEEccHHHHHHHHHHcccccHcHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccEEccccccccccccccHHHHHHHccHHHHHHcccccccccccccc
mseiigggqydescgyfiqptivqtkdplekimteeifgpvltifvypdkdldktlkivtdstpyaltgavfaedeSFQKRCLDDLKYAAGnyyindkstgsvvgqqpfggtndkaggphyvlrwatpqsiketfvpltewkypymg
mseiigggqydescgyfIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDSTPYALTgavfaedesfQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGTNDKAGGPHYVLrwatpqsiketfvpltewkypymg
MSEIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDSTPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGTNDKAGGPHYVLRWATPQSIKETFVPLTEWKYPYMG
****IGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDSTPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGTNDKAGGPHYVLRWATPQSIKETFVPLTEWKYPY**
MSEIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDSTPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGTNDKAGGPHYVLRWATPQSIKETFVPLTEWKYPYMG
MSEIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDSTPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGTNDKAGGPHYVLRWATPQSIKETFVPLTEWKYPYMG
MSEIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDSTPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGTNDKAGGPHYVLRWATPQSIKETFVPLTEWKYPYMG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDSTPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFGGTNDKAGGPHYVLRWATPQSIKETFVPLTEWKYPYMG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query147 2.2.26 [Sep-21-2011]
A7YWE4563 Delta-1-pyrroline-5-carbo yes N/A 0.972 0.253 0.614 2e-52
Q7SY23556 Delta-1-pyrroline-5-carbo yes N/A 0.979 0.258 0.624 3e-52
Q8CHT0562 Delta-1-pyrroline-5-carbo yes N/A 0.972 0.254 0.601 5e-50
P30038563 Delta-1-pyrroline-5-carbo yes N/A 0.972 0.253 0.587 1e-47
Q54RA2558 Delta-1-pyrroline-5-carbo yes N/A 0.986 0.259 0.56 6e-42
P0C2X9563 Delta-1-pyrroline-5-carbo yes N/A 0.952 0.248 0.519 8e-39
O74766548 Probable delta-1-pyrrolin yes N/A 0.965 0.259 0.462 7e-36
P07275575 Delta-1-pyrroline-5-carbo yes N/A 0.965 0.246 0.469 1e-34
Q9P8I0572 Delta-1-pyrroline-5-carbo yes N/A 0.965 0.248 0.46 3e-32
P78568546 Delta-1-pyrroline-5-carbo N/A N/A 0.965 0.260 0.469 1e-31
>sp|A7YWE4|AL4A1_BOVIN Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Bos taurus GN=ALDH4A1 PE=2 SV=1 Back     alignment and function desciption
 Score =  204 bits (518), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 91/148 (61%), Positives = 115/148 (77%), Gaps = 5/148 (3%)

Query: 4   IIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDST 63
           I+ GG  D+S GYF++P IV+TKDP + IM EEIFGPVL ++VYPD++  +TL++V  +T
Sbjct: 415 ILAGGHCDDSVGYFVEPCIVETKDPQDPIMKEEIFGPVLAVYVYPDEEYKETLRLVDSTT 474

Query: 64  PYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFG-----GTNDKAGG 118
            Y LTGAVFA+D+   +   + L++AAGN+YINDKSTGSVVGQQPFG     GTNDK GG
Sbjct: 475 SYGLTGAVFAQDKDVLREATELLRHAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGG 534

Query: 119 PHYVLRWATPQSIKETFVPLTEWKYPYM 146
           PHYVLRW +PQ IKET  PL +W+YPYM
Sbjct: 535 PHYVLRWTSPQVIKETHGPLGDWRYPYM 562




Irreversible conversion of delta-1-pyrroline-5-carboxylate (P5C), derived either from proline or ornithine, to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes.
Bos taurus (taxid: 9913)
EC: 1EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 2
>sp|Q7SY23|AL4A1_DANRE Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Danio rerio GN=aldh4a1 PE=2 SV=1 Back     alignment and function description
>sp|Q8CHT0|AL4A1_MOUSE Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Mus musculus GN=Aldh4a1 PE=1 SV=3 Back     alignment and function description
>sp|P30038|AL4A1_HUMAN Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Homo sapiens GN=ALDH4A1 PE=1 SV=3 Back     alignment and function description
>sp|Q54RA2|AL4A1_DICDI Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0283293 PE=3 SV=1 Back     alignment and function description
>sp|P0C2X9|AL4A1_RAT Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Aldh4a1 PE=1 SV=1 Back     alignment and function description
>sp|O74766|PUT2_SCHPO Probable delta-1-pyrroline-5-carboxylate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC24C6.04 PE=1 SV=1 Back     alignment and function description
>sp|P07275|PUT2_YEAST Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT2 PE=1 SV=2 Back     alignment and function description
>sp|Q9P8I0|PUT2_EMENI Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prnC PE=3 SV=2 Back     alignment and function description
>sp|P78568|PUT2_AGABI Delta-1-pyrroline-5-carboxylate dehydrogenase OS=Agaricus bisporus GN=pruA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
307181221 541 Delta-1-pyrroline-5-carboxylate dehydrog 0.979 0.266 0.758 5e-62
307200647 570 Delta-1-pyrroline-5-carboxylate dehydrog 0.979 0.252 0.724 9e-60
340728537 568 PREDICTED: LOW QUALITY PROTEIN: delta-1- 0.979 0.253 0.718 6e-59
350399488 568 PREDICTED: delta-1-pyrroline-5-carboxyla 0.979 0.253 0.718 7e-59
170042990 570 pyrroline-5-carboxylate dehydrogenase [C 0.979 0.252 0.731 3e-58
312375387 613 hypothetical protein AND_14227 [Anophele 0.972 0.233 0.722 6e-58
110760871 567 PREDICTED: delta-1-pyrroline-5-carboxyla 0.979 0.253 0.711 2e-57
345483689 568 PREDICTED: delta-1-pyrroline-5-carboxyla 0.979 0.253 0.718 4e-57
383847741 568 PREDICTED: delta-1-pyrroline-5-carboxyla 0.979 0.253 0.704 4e-57
347971770 573 AGAP004366-PA [Anopheles gambiae str. PE 0.972 0.249 0.722 6e-57
>gi|307181221|gb|EFN68918.1| Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  241 bits (616), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 113/149 (75%), Positives = 130/149 (87%), Gaps = 5/149 (3%)

Query: 3   EIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDS 62
           EI+GGG YD+SCGYFI+PTIVQ+KDP EK+MTEEIFGPVLTI+VY D DLDKT+K+V  S
Sbjct: 391 EILGGGGYDDSCGYFIEPTIVQSKDPKEKLMTEEIFGPVLTIYVYKDSDLDKTVKLVETS 450

Query: 63  TPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFG-----GTNDKAG 117
           TPYALTGA+FAEDE + K+ L+DLKY AGN+Y+NDKSTGSVVGQQPFG     GTNDKAG
Sbjct: 451 TPYALTGAIFAEDEKWAKKALEDLKYTAGNFYVNDKSTGSVVGQQPFGGSRMSGTNDKAG 510

Query: 118 GPHYVLRWATPQSIKETFVPLTEWKYPYM 146
           GPHY LRWA+PQSIKETF P+ E+ YPYM
Sbjct: 511 GPHYALRWASPQSIKETFAPIREYDYPYM 539




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307200647|gb|EFN80755.1| Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340728537|ref|XP_003402578.1| PREDICTED: LOW QUALITY PROTEIN: delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350399488|ref|XP_003485543.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|170042990|ref|XP_001849188.1| pyrroline-5-carboxylate dehydrogenase [Culex quinquefasciatus] gi|167866390|gb|EDS29773.1| pyrroline-5-carboxylate dehydrogenase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312375387|gb|EFR22772.1| hypothetical protein AND_14227 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|110760871|ref|XP_623512.2| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial-like [Apis mellifera] Back     alignment and taxonomy information
>gi|345483689|ref|XP_001601273.2| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383847741|ref|XP_003699511.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|347971770|ref|XP_313649.4| AGAP004366-PA [Anopheles gambiae str. PEST] gi|333469021|gb|EAA09247.4| AGAP004366-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
FB|FBgn0037138574 P5CDh1 "delta-1-Pyrroline-5-ca 0.979 0.250 0.671 6.5e-51
ZFIN|ZDB-GENE-040426-1179556 aldh4a1 "aldehyde dehydrogenas 0.979 0.258 0.624 1.5e-49
UNIPROTKB|A7YWE4563 ALDH4A1 "Delta-1-pyrroline-5-c 0.972 0.253 0.614 6e-48
UNIPROTKB|J9P2L3564 TAS1R2 "Taste receptor type 1 0.972 0.253 0.601 3.8e-46
MGI|MGI:2443883562 Aldh4a1 "aldehyde dehydrogenas 0.972 0.254 0.601 4.8e-46
UNIPROTKB|I3LNB4512 ALDH4A1 "Uncharacterized prote 0.965 0.277 0.605 1e-45
UNIPROTKB|E1C8Z8551 ALDH4A1 "Uncharacterized prote 0.972 0.259 0.567 2.1e-45
UNIPROTKB|P30038563 ALDH4A1 "Delta-1-pyrroline-5-c 0.972 0.253 0.587 3.4e-45
WB|WBGene00000112563 alh-6 [Caenorhabditis elegans 0.986 0.257 0.573 7.1e-45
DICTYBASE|DDB_G0283293558 DDB_G0283293 "putative delta-1 0.986 0.259 0.56 2.9e-39
FB|FBgn0037138 P5CDh1 "delta-1-Pyrroline-5-carboxylate dehydrogenase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 529 (191.3 bits), Expect = 6.5e-51, P = 6.5e-51
 Identities = 100/149 (67%), Positives = 119/149 (79%)

Query:     3 EIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDS 62
             EI+ GG Y +S GYF+ PTIV +KDP ++IMTEEIFGPVL+I+VY + DL +T+K+V  S
Sbjct:   424 EILAGGTYSDSKGYFVNPTIVLSKDPKDRIMTEEIFGPVLSIYVYKESDLLETMKLVHTS 483

Query:    63 TPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFGG-----TNDKAG 117
             T +ALTGAVF +DE F K  L + K AAGN+YINDKSTGSVVGQQPFGG     TNDKAG
Sbjct:   484 TKFALTGAVFGQDEDFVKCALQEFKMAAGNFYINDKSTGSVVGQQPFGGGRMSGTNDKAG 543

Query:   118 GPHYVLRWATPQSIKETFVPLTEWKYPYM 146
             GPHY+LRW +PQSIKETFVPL +  YPYM
Sbjct:   544 GPHYILRWTSPQSIKETFVPLRDVNYPYM 572




GO:0003842 "1-pyrroline-5-carboxylate dehydrogenase activity" evidence=ISS
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0006560 "proline metabolic process" evidence=ISS;IMP
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006561 "proline biosynthetic process" evidence=IEA
GO:0007005 "mitochondrion organization" evidence=IMP
GO:0005739 "mitochondrion" evidence=IDA
ZFIN|ZDB-GENE-040426-1179 aldh4a1 "aldehyde dehydrogenase 4 family, member A1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A7YWE4 ALDH4A1 "Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P2L3 TAS1R2 "Taste receptor type 1 member 2" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2443883 Aldh4a1 "aldehyde dehydrogenase 4 family, member A1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3LNB4 ALDH4A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8Z8 ALDH4A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P30038 ALDH4A1 "Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00000112 alh-6 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283293 DDB_G0283293 "putative delta-1-pyrroline-5-carboxylate dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7SY23AL4A1_DANRE1, ., 5, ., 1, ., 1, 20.62410.97950.2589yesN/A
A7YWE4AL4A1_BOVIN1, ., 5, ., 1, ., 1, 20.61480.97270.2539yesN/A
Q54RA2AL4A1_DICDI1, ., 5, ., 1, ., 1, 20.560.98630.2598yesN/A
P30038AL4A1_HUMAN1, ., 5, ., 1, ., 1, 20.58780.97270.2539yesN/A
Q8CHT0AL4A1_MOUSE1, ., 5, ., 1, ., 1, 20.60130.97270.2544yesN/A
P0C2X9AL4A1_RAT1, ., 5, ., 1, ., 1, 20.51970.95230.2486yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
cd07123522 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-ca 5e-83
TIGR01236532 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carb 1e-74
cd07083500 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent 8e-47
cd07124512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 1e-32
PRK03137514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 2e-31
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 3e-28
TIGR01237511 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carb 6e-28
COG1012472 COG1012, PutA, NAD-dependent aldehyde dehydrogenas 9e-27
pfam00171459 pfam00171, Aldedh, Aldehyde dehydrogenase family 3e-26
cd07125518 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car 2e-24
PRK119041038 PRK11904, PRK11904, bifunctional proline dehydroge 6e-24
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 2e-21
COG4230 769 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate 4e-20
PRK11905 1208 PRK11905, PRK11905, bifunctional proline dehydroge 6e-20
PRK11809 1318 PRK11809, putA, trifunctional transcriptional regu 5e-18
cd07131478 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candi 5e-17
TIGR01238500 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carb 9e-17
PTZ00381493 PTZ00381, PTZ00381, aldehyde dehydrogenase family 2e-16
cd07145456 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcu 5e-16
cd07087426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 4e-15
cd07098465 cd07098, ALDH_F15-22, Aldehyde dehydrogenase famil 1e-14
cd07099453 cd07099, ALDH_DDALDH, Methylomonas sp 1e-14
cd07118454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 1e-14
cd07091476 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH 1e-14
cd07134433 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehy 2e-14
cd07136449 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldeh 8e-14
cd07138466 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-ox 2e-13
cd07106446 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofac 4e-13
cd07109454 cd07109, ALDH_AAS00426, Uncharacterized Saccharopo 4e-13
cd07143481 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans al 1e-12
cd07104431 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P) 1e-12
PRK09406457 PRK09406, gabD1, succinic semialdehyde dehydrogena 1e-12
cd07113477 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dep 2e-12
cd07144484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 2e-12
cd07086478 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha 2e-12
cd07132443 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 4e-12
cd07115453 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4e-12
cd07117475 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylo 5e-12
cd07093455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 7e-12
cd07119482 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-de 7e-12
TIGR04284480 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, 9e-12
cd07137432 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase 9e-12
cd07107456 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxyben 1e-11
cd07097473 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+ 1e-11
cd07090457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 1e-11
cd07559480 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophu 1e-11
cd07112462 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+ 2e-11
cd07103451 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina 2e-11
cd07100429 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tubercul 2e-11
cd07135436 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisia 2e-11
cd07092450 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-d 2e-11
TIGR01804467 TIGR01804, BADH, glycine betaine aldehyde dehydrog 2e-11
cd07088468 cd07088, ALDH_LactADH-AldA, Escherichia coli lacta 4e-11
cd07139471 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculo 5e-11
cd07149453 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) wi 6e-11
cd07150451 cd07150, ALDH_VaniDH_like, Pseudomonas putida vani 7e-11
PLN02203484 PLN02203, PLN02203, aldehyde dehydrogenase 1e-10
cd07140486 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate 3e-10
cd07089459 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6- 3e-10
PRK10090409 PRK10090, PRK10090, aldehyde dehydrogenase A; Prov 3e-10
cd07094453 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NA 4e-10
TIGR02299488 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate 5e-10
cd07141481 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retin 5e-10
cd07152443 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde 7e-10
cd07148455 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL031 7e-10
TIGR01780448 TIGR01780, SSADH, succinate-semialdehyde dehydroge 9e-10
cd07095431 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-sem 1e-09
cd07114457 cd07114, ALDH_DhaS, Uncharacterized Candidatus pel 1e-09
cd07147452 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase f 1e-09
cd07110456 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehy 1e-09
PLN02466538 PLN02466, PLN02466, aldehyde dehydrogenase family 4e-09
cd07105432 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogena 4e-09
cd07133434 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehyd 5e-09
cd07108457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 8e-09
cd07142476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 9e-09
cd07120455 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida al 2e-08
cd07151465 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxyb 7e-08
PRK09847494 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobuty 7e-08
PLN02315508 PLN02315, PLN02315, aldehyde dehydrogenase family 2e-07
PRK13252488 PRK13252, PRK13252, betaine aldehyde dehydrogenase 2e-07
PLN02467503 PLN02467, PLN02467, betaine aldehyde dehydrogenase 3e-07
cd07102452 cd07102, ALDH_EDX86601, Uncharacterized aldehyde d 3e-07
PRK13473475 PRK13473, PRK13473, gamma-aminobutyraldehyde dehyd 4e-07
TIGR03374472 TIGR03374, ABALDH, 1-pyrroline dehydrogenase 4e-07
cd07101454 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul 4e-07
cd07146451 cd07146, ALDH_PhpJ, Streptomyces putative phosphon 6e-07
cd07085478 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyd 9e-07
cd07116479 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD 1e-06
PRK09407524 PRK09407, gabD2, succinic semialdehyde dehydrogena 3e-06
TIGR03250472 TIGR03250, PhnAcAld_DH, putative phosphonoacetalde 1e-05
TIGR03216481 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semia 2e-05
cd07082473 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-ph 2e-05
cd07130474 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-amin 2e-05
PRK11241482 PRK11241, gabD, succinate-semialdehyde dehydrogena 8e-05
cd07111480 cd07111, ALDH_F16, Aldehyde dehydrogenase family 1 9e-05
PLN02174484 PLN02174, PLN02174, aldehyde dehydrogenase family 1e-04
TIGR03240484 TIGR03240, arg_catab_astD, succinylglutamic semial 1e-04
TIGR01722477 TIGR01722, MMSDH, methylmalonic acid semialdehyde 2e-04
PLN02278498 PLN02278, PLN02278, succinic semialdehyde dehydrog 2e-04
PRK13968462 PRK13968, PRK13968, putative succinate semialdehyd 3e-04
cd07129454 cd07129, ALDH_KGSADH, Alpha-Ketoglutaric Semialdeh 6e-04
PLN02766501 PLN02766, PLN02766, coniferyl-aldehyde dehydrogena 7e-04
cd07128513 cd07128, ALDH_MaoC-N, N-terminal domain of the mon 0.004
>gnl|CDD|143441 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
 Score =  252 bits (646), Expect = 5e-83
 Identities = 85/140 (60%), Positives = 111/140 (79%), Gaps = 5/140 (3%)

Query: 3   EIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDS 62
           EII GG+ D+S GYF++PT+++T DP  K+MTEEIFGPVLT++VYPD D ++TL++V  +
Sbjct: 383 EIIAGGKCDDSVGYFVEPTVIETTDPKHKLMTEEIFGPVLTVYVYPDSDFEETLELVDTT 442

Query: 63  TPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFG-----GTNDKAG 117
           +PYALTGA+FA+D    +   D L+ AAGN+YINDK TG+VVGQQPFG     GTNDKAG
Sbjct: 443 SPYALTGAIFAQDRKAIREATDALRNAAGNFYINDKPTGAVVGQQPFGGARASGTNDKAG 502

Query: 118 GPHYVLRWATPQSIKETFVP 137
            P  +LRW +P++IKETFVP
Sbjct: 503 SPLNLLRWVSPRTIKETFVP 522


Delta(1)-pyrroline-5-carboxylate dehydrogenase (EC=1.5.1.12 ), families 4 and 17: a proline catabolic enzyme of the aldehyde dehydrogenase (ALDH) protein superfamily. Delta(1)-pyrroline-5-carboxylate dehydrogenase (P5CDH), also known as ALDH4A1 in humans, is a mitochondrial homodimer involved in proline degradation and catalyzes the NAD + -dependent conversion of P5C to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes. Also included in this CD is the Aldh17 Drosophila melanogaster (Q9VUC0) P5CDH and similar sequences. Length = 522

>gnl|CDD|233324 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>gnl|CDD|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|200087 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>gnl|CDD|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>gnl|CDD|237017 PRK11904, PRK11904, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|237018 PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|236989 PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143449 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>gnl|CDD|233325 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>gnl|CDD|240392 PTZ00381, PTZ00381, aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>gnl|CDD|143463 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|143416 cd07098, ALDH_F15-22, Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>gnl|CDD|143417 cd07099, ALDH_DDALDH, Methylomonas sp Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>gnl|CDD|143454 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143424 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>gnl|CDD|143427 cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>gnl|CDD|143461 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>gnl|CDD|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|181826 PRK09406, gabD1, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143431 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143450 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143435 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|143437 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|212007 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, Rv0768 family Back     alignment and domain information
>gnl|CDD|143455 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>gnl|CDD|143425 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>gnl|CDD|143415 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|143471 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>gnl|CDD|143430 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>gnl|CDD|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>gnl|CDD|143418 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>gnl|CDD|143453 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>gnl|CDD|143411 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>gnl|CDD|200131 TIGR01804, BADH, glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143467 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>gnl|CDD|165847 PLN02203, PLN02203, aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143458 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>gnl|CDD|182233 PRK10090, PRK10090, aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|143413 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>gnl|CDD|131352 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143459 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>gnl|CDD|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143466 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|188167 TIGR01780, SSADH, succinate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143414 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>gnl|CDD|143465 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>gnl|CDD|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>gnl|CDD|215259 PLN02466, PLN02466, aldehyde dehydrogenase family 2 member Back     alignment and domain information
>gnl|CDD|143423 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>gnl|CDD|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>gnl|CDD|143438 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>gnl|CDD|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|182108 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177949 PLN02315, PLN02315, aldehyde dehydrogenase family 7 member Back     alignment and domain information
>gnl|CDD|183918 PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215260 PLN02467, PLN02467, betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>gnl|CDD|237391 PRK13473, PRK13473, gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase Back     alignment and domain information
>gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>gnl|CDD|143464 cd07146, ALDH_PhpJ, Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>gnl|CDD|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>gnl|CDD|143434 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|236501 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|132294 TIGR03250, PhnAcAld_DH, putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|132260 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143401 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>gnl|CDD|143448 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>gnl|CDD|183050 PRK11241, gabD, succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|143429 cd07111, ALDH_F16, Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>gnl|CDD|177831 PLN02174, PLN02174, aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>gnl|CDD|132284 TIGR03240, arg_catab_astD, succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|130783 TIGR01722, MMSDH, methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|215157 PLN02278, PLN02278, succinic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|184426 PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143447 cd07129, ALDH_KGSADH, Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>gnl|CDD|215410 PLN02766, PLN02766, coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143446 cd07128, ALDH_MaoC-N, N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 147
PLN02174484 aldehyde dehydrogenase family 3 member H1 100.0
TIGR01236533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 100.0
PTZ00381493 aldehyde dehydrogenase family protein; Provisional 99.98
KOG2450|consensus501 99.97
PLN02203484 aldehyde dehydrogenase 99.97
PRK11241482 gabD succinate-semialdehyde dehydrogenase I; Provi 99.97
cd07123522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 99.97
cd07140486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 99.97
COG1012472 PutA NAD-dependent aldehyde dehydrogenases [Energy 99.97
cd07136449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 99.97
PLN02766501 coniferyl-aldehyde dehydrogenase 99.97
TIGR03374472 ABALDH 1-pyrroline dehydrogenase. Members of this 99.97
PLN02419604 methylmalonate-semialdehyde dehydrogenase [acylati 99.97
KOG2455|consensus561 99.97
KOG2456|consensus477 99.97
PLN02278498 succinic semialdehyde dehydrogenase 99.97
PRK10090409 aldehyde dehydrogenase A; Provisional 99.97
cd07132443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 99.97
cd07141481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 99.96
TIGR01780448 SSADH succinate-semialdehyde dehydrogenase. SSADH 99.96
cd07099453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 99.96
PLN02466538 aldehyde dehydrogenase family 2 member 99.96
PRK09406457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 99.96
TIGR03216481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 99.96
cd07113477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 99.96
PRK13473475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 99.96
PRK13968462 putative succinate semialdehyde dehydrogenase; Pro 99.96
PLN02315508 aldehyde dehydrogenase family 7 member 99.96
cd07124512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 99.96
cd07107456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 99.96
cd07133434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 99.96
cd07117475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 99.96
cd07106446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 99.96
cd07142476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 99.96
PRK13252488 betaine aldehyde dehydrogenase; Provisional 99.96
cd07083500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 99.96
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 99.96
cd07559480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 99.96
PRK03137514 1-pyrroline-5-carboxylate dehydrogenase; Provision 99.96
cd07137432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 99.96
cd07085478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 99.96
cd07094453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 99.96
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 99.96
TIGR01237511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 99.96
cd07130474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 99.96
TIGR03250472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 99.96
cd07134433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 99.96
TIGR02299488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 99.96
cd07143481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 99.96
cd07116479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 99.96
cd07091476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 99.96
cd07097473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 99.96
cd07151465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 99.96
cd07100429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 99.96
cd07144484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 99.96
PLN00412496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 99.96
PRK09407524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 99.96
cd07092450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 99.96
cd07119482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 99.96
cd07147452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 99.96
cd07139471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 99.96
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 99.96
cd07105432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 99.96
cd07152443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 99.96
cd07135436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 99.96
cd07115453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 99.96
cd07089459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 99.96
cd07090457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 99.96
cd07110456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 99.96
cd07102452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 99.96
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 99.96
cd07118454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 99.96
cd07088468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 99.96
PLN02467503 betaine aldehyde dehydrogenase 99.96
cd07120455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 99.95
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 99.95
PF00171462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 99.95
cd07145456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 99.95
cd07109454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 99.95
cd07146451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 99.95
cd07148455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 99.95
cd07108457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 99.95
cd07150451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 99.95
cd07104431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 99.95
cd07125518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 99.95
cd07112462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 99.95
cd07114457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 99.95
TIGR01804467 BADH glycine betaine aldehyde dehydrogenase. Betai 99.95
cd07103451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 99.95
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 99.95
cd07087426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 99.95
cd07111480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 99.95
cd07138466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 99.95
cd07149453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 99.95
PRK09457487 astD succinylglutamic semialdehyde dehydrogenase; 99.95
cd07128513 ALDH_MaoC-N N-terminal domain of the monoamine oxi 99.95
cd07082473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 99.95
KOG2451|consensus503 99.95
TIGR02278 663 PaaN-DH phenylacetic acid degradation protein paaN 99.95
TIGR03240484 arg_catab_astD succinylglutamic semialdehyde dehyd 99.95
cd07093455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 99.95
cd07095431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 99.95
PRK11563 675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 99.94
PRK11903521 aldehyde dehydrogenase; Provisional 99.94
PRK119041038 bifunctional proline dehydrogenase/pyrroline-5-car 99.94
cd07078432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 99.94
cd07084442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 99.93
cd07129454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 99.93
TIGR01238500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 99.93
KOG2454|consensus583 99.92
PRK11905 1208 bifunctional proline dehydrogenase/pyrroline-5-car 99.92
KOG2452|consensus881 99.92
cd07126489 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de 99.92
PRK11809 1318 putA trifunctional transcriptional regulator/proli 99.91
cd07079406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 99.9
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 99.9
PRK00197417 proA gamma-glutamyl phosphate reductase; Provision 99.9
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 99.88
PRK15398465 aldehyde dehydrogenase EutE; Provisional 99.87
KOG2453|consensus507 99.86
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 99.86
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 99.86
cd07077397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 99.82
cd07081439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 99.81
cd07127549 ALDH_PAD-PaaZ Phenylacetic acid degradation protei 99.8
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 99.79
TIGR02288551 PaaN_2 phenylacetic acid degradation protein paaN. 99.77
COG4230 769 Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene 99.74
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 99.73
TIGR02518488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 99.65
cd07122436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 99.64
KOG2449|consensus157 99.47
COG0014417 ProA Gamma-glutamyl phosphate reductase [Amino aci 98.27
KOG4165|consensus433 96.12
PF07368215 DUF1487: Protein of unknown function (DUF1487); In 93.5
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
Probab=100.00  E-value=7.9e-33  Score=232.32  Aligned_cols=139  Identities=25%  Similarity=0.431  Sum_probs=123.3

Q ss_pred             eEEEECCcccCCCCceEecEEEEeCCCCCcccccccccceEEEEEcCCCCHHHHHHHHhhCCCCccEEEEEcCCHHHHHH
Q psy1961           2 SEIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDSTPYALTGAVFAEDESFQKR   81 (147)
Q Consensus         2 a~v~~GG~~~~~~g~~~~Ptvl~~v~~~~~i~~eE~FGPvl~v~~~~~~~~~eai~~a~n~~~~gL~~~vft~d~~~~~~   81 (147)
                      |++++||..+ ..|+|++|||+.+++++|++++||+||||++|++|+|  .||||+++ |+++|||++||||+|.+++.+
T Consensus       314 a~~~~GG~~~-~~g~~~~PTvl~~v~~~~~i~~eEiFGPVl~v~~~~~--~~eai~~a-N~~~~gLaa~vft~d~~~a~~  389 (484)
T PLN02174        314 DKIVYGGEKD-RENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNN--LEESFDVI-RSRPKPLAAYLFTHNKKLKER  389 (484)
T ss_pred             CEEEECCCcC-CCCCEEEEEEEecCCCCChhhcCCcCCCeEEEecCCC--HHHHHHHH-hCCCCCeEEEEEcCCHHHHHH
Confidence            5789999654 3589999999999999999999999999999999998  69999999 999999999999999999999


Q ss_pred             HHhhccCceeEEEEcCCCCCCCCCCccccC----cCCCCChHHHHhhcceeceEEEe-cCCCCcCCCCCC
Q psy1961          82 CLDDLKYAAGNYYINDKSTGSVVGQQPFGG----TNDKAGGPHYVLRWATPQSIKET-FVPLTEWKYPYM  146 (147)
Q Consensus        82 ~~~~~~~~~G~v~iN~~~~~~~~~~~pfGG----~~g~~~g~~~~~~f~~~k~v~~~-~~~~~~~~~p~~  146 (147)
                      +++++  ++|.|+||+...+...+.+||||    |.|+++|.+++++|++.|+|+.+ .+.+.+++||+.
T Consensus       390 ~~~~l--~aG~v~IN~~~~~~~~~~~PfGG~k~SG~Gr~~G~~gl~~ft~~K~v~~~~~~~~~~~~~pp~  457 (484)
T PLN02174        390 FAATV--SAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSLFGDSAVRYPPY  457 (484)
T ss_pred             HHHcC--CcceEEECCCcCCCCCCCCCCCCcCccccCccchHHHHHHhcceEEEEECCccCcccccCCCC
Confidence            99986  99999999987654346789999    77889999999999999999855 345678999764



>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>KOG2450|consensus Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>KOG2455|consensus Back     alignment and domain information
>KOG2456|consensus Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>KOG2451|consensus Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11903 aldehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>KOG2454|consensus Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2452|consensus Back     alignment and domain information
>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>KOG2453|consensus Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>cd07127 ALDH_PAD-PaaZ Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>KOG2449|consensus Back     alignment and domain information
>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4165|consensus Back     alignment and domain information
>PF07368 DUF1487: Protein of unknown function (DUF1487); InterPro: IPR009961 This family consists of several uncharacterised proteins from Drosophila melanogaster Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
3v9j_A563 Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylat 2e-50
3v9g_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 2e-48
3v9h_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 2e-48
3v9i_A566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 2e-48
3rjl_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 2e-20
3qan_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 9e-20
4f9i_A1026 Crystal Structure Of Proline Utilization A (Puta) F 2e-17
1uzb_A516 1-pyrroline-5-carboxylate Dehydrogenase Length = 51 3e-17
2bhp_A516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 3e-17
2bja_A516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 3e-17
3haz_A1001 Crystal Structure Of Bifunctional Proline Utilizati 2e-16
3ed6_A520 1.7 Angstrom Resolution Crystal Structure Of Betain 1e-07
1ad3_A452 Class 3 Aldehyde Dehydrogenase Complex With Nicotin 1e-07
3ty7_A478 Crystal Structure Of Aldehyde Dehydrogenase Family 3e-07
3r31_A517 Crystal Structure Of Betaine Aldehyde Dehydrogenase 4e-07
2d4e_A515 Crystal Structure Of The Hpcc From Thermus Thermoph 6e-07
3rhl_A517 Crystal Structure Of The E673aC707A DOUBLE MUTANT O 9e-07
4gnz_A517 Crystal Structure Of The C707s Mutant Of C-terminal 9e-07
3rhr_A517 Crystal Structure Of The C707a Mutant Of The C-Term 9e-07
2o2p_A517 Crystal Structure Of The C-Terminal Domain Of Rat 1 1e-06
3rhm_A517 Crystal Structure Of The E673q Mutant Of C-Terminal 1e-06
3rhj_A517 Crystal Structure Of The E673a Mutant Of The C-Term 1e-06
1bxs_A501 Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad 1e-06
4dal_A498 Crystal Structure Of Putative Aldehyde Dehydrogenas 1e-06
3i44_A497 Crystal Structure Of Aldehyde Dehydrogenase From Ba 1e-06
4a0m_A496 Crystal Structure Of Betaine Aldehyde Dehydrogenase 1e-06
1o9j_A501 The X-Ray Crystal Structure Of Eta-Crystallin Lengt 2e-06
2opx_A479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 2e-06
1zum_A500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 3e-06
3inl_A500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 3e-06
1nzw_A500 Cys302ser Mutant Of Human Mitochondrial Aldehyde De 3e-06
3n80_A500 Human Mitochondrial Aldehyde Dehydrogenase, Apo For 3e-06
1o05_A500 Apo Form Of Human Mitochondrial Aldehyde Dehydrogen 3e-06
4fr8_A500 Crystal Structure Of Human Aldehyde Dehydrogenase-2 3e-06
3n81_A500 T244a Mutant Of Human Mitochondrial Aldehyde Dehydr 3e-06
2onn_A500 Arg475gln Mutant Of Human Mitochondrial Aldehyde De 3e-06
2imp_A479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 3e-06
2hg2_A479 Structure Of Lactaldehyde Dehydrogenase Length = 47 3e-06
1cw3_A494 Human Mitochondrial Aldehyde Dehydrogenase Complexe 3e-06
1bi9_A499 Retinal Dehydrogenase Type Two With Nad Bound Lengt 3e-06
4i8p_A520 Crystal Structure Of Aminoaldehyde Dehydrogenase 1a 5e-06
1a4s_A503 Betaine Aldehyde Dehydrogenase From Cod Liver Lengt 6e-06
3sza_A469 Crystal Structure Of Human Aldh3a1 - Apo Form Lengt 7e-06
4i9b_A517 Structure Of Aminoaldehyde Dehydrogenase 1 From Sol 1e-05
1ag8_A499 Aldehyde Dehydrogenase From Bovine Mitochondria Len 1e-05
2xdr_A489 Crystallographic Structure Of Betaine Aldehyde Dehy 1e-05
2wme_A490 Crystallographic Structure Of Betaine Aldehyde Dehy 1e-05
2wox_A489 Betaine Aldehyde Dehydrogenase From Pseudomonas Aer 1e-05
4i8q_A514 Structure Of The Aminoaldehyde Dehydrogenase 1 E260 1e-05
3zqa_A490 Crystallographic Structure Of Betaine Aldehyde Dehy 1e-05
2wme_C490 Crystallographic Structure Of Betaine Aldehyde Dehy 1e-05
4h7n_A474 The Structure Of Putative Aldehyde Dehydrogenase Pu 1e-05
3b4w_A495 Crystal Structure Of Mycobacterium Tuberculosis Ald 2e-05
3iwk_A503 Crystal Structure Of Aminoaldehyde Dehydrogenase 1 2e-05
3iwj_A503 Crystal Structure Of Aminoaldehyde Dehydrogenase 2 3e-05
3jz4_C481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 6e-05
3jz4_A481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 6e-05
1wnb_A495 Escherichia Coli Ydcw Gene Product Is A Medium-Chai 3e-04
3ros_A484 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 4e-04
3u4j_A528 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 8e-04
>pdb|3V9J|A Chain A, Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylate Dehydrogenase Complexed With Sulfate Ion Length = 563 Back     alignment and structure

Iteration: 1

Score = 193 bits (491), Expect = 2e-50, Method: Compositional matrix adjust. Identities = 90/148 (60%), Positives = 113/148 (76%), Gaps = 5/148 (3%) Query: 4 IIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDST 63 I+ GGQ +ES GY+++P I+++KDP E IM EEIFGPVLT++VYPD +TLK+V +T Sbjct: 415 ILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLKLVDSTT 474 Query: 64 PYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFG-----GTNDKAGG 118 Y LTGAVFA+D++ + L+ AAGN+YINDKSTGSVVGQQPFG GTNDK GG Sbjct: 475 SYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGG 534 Query: 119 PHYVLRWATPQSIKETFVPLTEWKYPYM 146 PHY+LRW +PQ IKET PL +W+Y YM Sbjct: 535 PHYILRWTSPQVIKETHKPLGDWRYSYM 562
>pdb|3V9G|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Length = 566 Back     alignment and structure
>pdb|3V9H|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352a Length = 566 Back     alignment and structure
>pdb|3V9I|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352l Length = 566 Back     alignment and structure
>pdb|3RJL|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Licheniformis (Target Nysgrc-000337) Length = 538 Back     alignment and structure
>pdb|3QAN|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Halodurans Length = 538 Back     alignment and structure
>pdb|4F9I|A Chain A, Crystal Structure Of Proline Utilization A (Puta) From Geobacter Sulfurreducens Pca Length = 1026 Back     alignment and structure
>pdb|1UZB|A Chain A, 1-pyrroline-5-carboxylate Dehydrogenase Length = 516 Back     alignment and structure
>pdb|2BHP|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nad. Length = 516 Back     alignment and structure
>pdb|2BJA|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nadh Length = 516 Back     alignment and structure
>pdb|3HAZ|A Chain A, Crystal Structure Of Bifunctional Proline Utilization A (Puta) Protein Length = 1001 Back     alignment and structure
>pdb|3ED6|A Chain A, 1.7 Angstrom Resolution Crystal Structure Of Betaine Aldehyde Dehydrogenase (Betb) From Staphylococcus Aureus Length = 520 Back     alignment and structure
>pdb|1AD3|A Chain A, Class 3 Aldehyde Dehydrogenase Complex With Nicotinamide- Adenine-Dinucleotide Length = 452 Back     alignment and structure
>pdb|3TY7|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase Family Protein From Staphylococcus Aureus Length = 478 Back     alignment and structure
>pdb|3R31|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Agrobacterium Tumefaciens Length = 517 Back     alignment and structure
>pdb|2D4E|A Chain A, Crystal Structure Of The Hpcc From Thermus Thermophilus Hb8 Length = 515 Back     alignment and structure
>pdb|3RHL|A Chain A, Crystal Structure Of The E673aC707A DOUBLE MUTANT OF THE C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|4GNZ|A Chain A, Crystal Structure Of The C707s Mutant Of C-terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadp Length = 517 Back     alignment and structure
>pdb|3RHR|A Chain A, Crystal Structure Of The C707a Mutant Of The C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadph Length = 517 Back     alignment and structure
>pdb|2O2P|A Chain A, Crystal Structure Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|3RHM|A Chain A, Crystal Structure Of The E673q Mutant Of C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|3RHJ|A Chain A, Crystal Structure Of The E673a Mutant Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|1BXS|A Chain A, Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad Bound Length = 501 Back     alignment and structure
>pdb|4DAL|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 498 Back     alignment and structure
>pdb|3I44|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Bartonella Henselae At 2.0a Resolution Length = 497 Back     alignment and structure
>pdb|4A0M|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Spinach In Complex With Nad Length = 496 Back     alignment and structure
>pdb|1O9J|A Chain A, The X-Ray Crystal Structure Of Eta-Crystallin Length = 501 Back     alignment and structure
>pdb|2OPX|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From Escherichia Coli Length = 479 Back     alignment and structure
>pdb|1ZUM|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Apo Form Length = 500 Back     alignment and structure
>pdb|3INL|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Complexed With Agonist Alda-1 Length = 500 Back     alignment and structure
>pdb|1NZW|A Chain A, Cys302ser Mutant Of Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nadh And Mg2+ Length = 500 Back     alignment and structure
>pdb|3N80|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|1O05|A Chain A, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|4FR8|A Chain A, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In Complex With Nitroglycerin Length = 500 Back     alignment and structure
>pdb|3N81|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|2ONN|A Chain A, Arg475gln Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|2IMP|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From E. Coli: The Ternary Complex With Product Bound (L)-Lactate And Nadh. Length = 479 Back     alignment and structure
>pdb|2HG2|A Chain A, Structure Of Lactaldehyde Dehydrogenase Length = 479 Back     alignment and structure
>pdb|1CW3|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nad+ And Mn2+ Length = 494 Back     alignment and structure
>pdb|1BI9|A Chain A, Retinal Dehydrogenase Type Two With Nad Bound Length = 499 Back     alignment and structure
>pdb|4I8P|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1a From Zea Mays (zmamadh1a) Length = 520 Back     alignment and structure
>pdb|1A4S|A Chain A, Betaine Aldehyde Dehydrogenase From Cod Liver Length = 503 Back     alignment and structure
>pdb|3SZA|A Chain A, Crystal Structure Of Human Aldh3a1 - Apo Form Length = 469 Back     alignment and structure
>pdb|4I9B|A Chain A, Structure Of Aminoaldehyde Dehydrogenase 1 From Solanum Lycopersium (slamadh1) With A Thiohemiacetal Intermediate Length = 517 Back     alignment and structure
>pdb|1AG8|A Chain A, Aldehyde Dehydrogenase From Bovine Mitochondria Length = 499 Back     alignment and structure
>pdb|2XDR|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant E252a From Pseudomonas Aeruginosa Length = 489 Back     alignment and structure
>pdb|2WME|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|2WOX|A Chain A, Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa With Nad(P)h-Catalytic Thiol Adduct. Length = 489 Back     alignment and structure
>pdb|4I8Q|A Chain A, Structure Of The Aminoaldehyde Dehydrogenase 1 E260a Mutant From Solanum Lycopersicum (slamadh1-e260a) Length = 514 Back     alignment and structure
>pdb|3ZQA|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant C286a From Pseudomonas Aeruginosa In Complex With Nadph Length = 490 Back     alignment and structure
>pdb|2WME|C Chain C, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|4H7N|A Chain A, The Structure Of Putative Aldehyde Dehydrogenase Puta From Anabaena Variabilis. Length = 474 Back     alignment and structure
>pdb|3B4W|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Aldehyde Dehydrogenase Complexed With Nad+ Length = 495 Back     alignment and structure
>pdb|3IWK|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1 From Pisum Sativum (Psamadh1) Length = 503 Back     alignment and structure
>pdb|3IWJ|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 2 From Pisum Sativum (Psamadh2) Length = 503 Back     alignment and structure
>pdb|3JZ4|C Chain C, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|3JZ4|A Chain A, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|1WNB|A Chain A, Escherichia Coli Ydcw Gene Product Is A Medium-Chain Aldehyde Dehydrogenase (Complexed With Nadh And Betaine Aldehyde) Length = 495 Back     alignment and structure
>pdb|3ROS|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Lactobacillus Acidophilus Length = 484 Back     alignment and structure
>pdb|3U4J|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Sinorhizobium Meliloti Length = 528 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 3e-84
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 4e-50
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 2e-37
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 6e-36
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 8e-35
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 1e-16
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 1e-15
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 1e-15
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 2e-15
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 2e-15
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 2e-15
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 4e-15
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 6e-15
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 7e-15
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 9e-15
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 1e-14
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 2e-14
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 2e-14
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 2e-14
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 3e-14
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 3e-14
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 4e-14
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 6e-14
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 6e-14
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 7e-14
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 1e-13
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 1e-13
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 2e-13
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 3e-13
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 4e-13
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 4e-13
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 1e-12
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 2e-12
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 3e-12
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 6e-11
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 1e-10
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 4e-09
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 7e-09
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 9e-09
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 9e-09
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 1e-08
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 5e-07
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 1e-06
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 1e-06
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 3e-06
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 5e-04
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
 Score =  256 bits (655), Expect = 3e-84
 Identities = 90/149 (60%), Positives = 113/149 (75%), Gaps = 5/149 (3%)

Query: 3   EIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDS 62
            I+ GGQ +ES GY+++P I+++KDP E IM EEIFGPVLT++VYPD    +TLK+V  +
Sbjct: 414 SILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLKLVDST 473

Query: 63  TPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFGG-----TNDKAG 117
           T Y LTGAVFA+D++  +     L+ AAGN+YINDKSTGSVVGQQPFGG     TNDK G
Sbjct: 474 TSYGLTGAVFAQDKAIVQEATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPG 533

Query: 118 GPHYVLRWATPQSIKETFVPLTEWKYPYM 146
           GPHY+LRW +PQ IKET  PL +W+Y YM
Sbjct: 534 GPHYILRWTSPQVIKETHKPLGDWRYSYM 562


>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469 Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Length = 478 Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Length = 497 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500 Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486 Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Length = 462 Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497 Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Length = 506 Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487 Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Length = 484 Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Length = 504 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Length = 452 Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Length = 486 Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Length = 521 Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Length = 464 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 100.0
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 100.0
2wme_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
4h7n_A474 Aldehyde dehydrogenase; structural genomics, PSI-b 99.97
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 99.97
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 99.97
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 99.97
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 99.97
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 99.97
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 99.97
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 99.97
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 99.97
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 99.97
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 99.97
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 99.97
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 99.97
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 99.97
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 99.97
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 99.97
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 99.97
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 99.97
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 99.97
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 99.97
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 99.97
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 99.97
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 99.97
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 99.96
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 99.96
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 99.96
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 99.96
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 99.96
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 99.96
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 99.96
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 99.96
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 99.96
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 99.96
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 99.96
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 99.96
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 99.96
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 99.96
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 99.95
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 99.95
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 99.94
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 99.94
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 99.93
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 99.93
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 99.91
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 99.89
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 99.88
4ghk_A444 Gamma-glutamyl phosphate reductase; structural gen 99.87
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 99.83
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 99.7
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
Probab=100.00  E-value=9.6e-35  Score=246.65  Aligned_cols=146  Identities=60%  Similarity=1.100  Sum_probs=130.8

Q ss_pred             eEEEECCcccCCCCceEecEEEEeCCCCCcccccccccceEEEEEcCCCCHHHHHHHHhhCCCCccEEEEEcCCHHHHHH
Q psy1961           2 SEIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDSTPYALTGAVFAEDESFQKR   81 (147)
Q Consensus         2 a~v~~GG~~~~~~g~~~~Ptvl~~v~~~~~i~~eE~FGPvl~v~~~~~~~~~eai~~a~n~~~~gL~~~vft~d~~~~~~   81 (147)
                      |++++||..+...|+|++|||+.+++++|++++||+||||++|++|+++++||||+++.|+++|||+++|||+|.+++.+
T Consensus       413 a~v~~GG~~~~~~G~fv~PTvl~~v~~~~~i~~eEiFGPVl~V~~~~d~~~deAi~~ann~s~yGLta~V~t~d~~~~~~  492 (563)
T 4e3x_A          413 LSILAGGQCNESVGYYVEPCIIESKDPQEPIMKEEIFGPVLTVYVYPDDKYRETLKLVDSTTSYGLTGAVFAQDKAIVQE  492 (563)
T ss_dssp             EEEEECCCEECSSSCEECCEEEEESCTTCGGGTSCCCSSEEEEEEECGGGHHHHHHHHHHSSSEESEEEEECSCHHHHHH
T ss_pred             CEEEeCCccCCCCCcEecCEEEecCCCCChhhcCCCcCeEEEEEEECCCCHHHHHHHHHcCCCCCCEEEEEeCCHHHHHH
Confidence            58999998765579999999999999999999999999999999999755799999982389999999999999999999


Q ss_pred             HHhhccCceeEEEEcCCCCCCCCCCccccC----cCC-CCChHHHHhhcceeceEEEecCCCCcCCCCCCC
Q psy1961          82 CLDDLKYAAGNYYINDKSTGSVVGQQPFGG----TND-KAGGPHYVLRWATPQSIKETFVPLTEWKYPYMG  147 (147)
Q Consensus        82 ~~~~~~~~~G~v~iN~~~~~~~~~~~pfGG----~~g-~~~g~~~~~~f~~~k~v~~~~~~~~~~~~p~~~  147 (147)
                      +++.+++++|.|+||+..++...+.+||||    |.| +.+|++++.+|++.|+|++++.+..+++||+|+
T Consensus       493 ~~~~l~~~aG~v~IN~~~~~~~~~~~PFGG~k~SG~g~~~~G~~~l~~~~~~k~v~~~~~~~~~~~yp~~~  563 (563)
T 4e3x_A          493 ATRMLRNAAGNFYINDKSTGSVVGQQPFGGARASGTNDKPGGPHYILRWTSPQVIKETHKPLGDWRYSYMQ  563 (563)
T ss_dssp             HHHHTTTTCSEEEESSCSCCCCTTTSCCCCEETTBCCCCTTSTTGGGGGBCCEEEEEECSCCCCSSCTTCC
T ss_pred             HHHhhhcCeeEEEEcCCCCCCCcCCCCCCCccccCCCCccCCHHHHHHhCceEEEEEeCcCCCcccCCCCC
Confidence            999864469999999987665557899999    444 788999999999999999999899999999995



>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 147
d1uzba_516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 3e-36
d1o04a_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 4e-28
d1bxsa_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 5e-27
d1a4sa_503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 4e-25
d1wnda_474 c.82.1.1 (A:) Putative betaine aldehyde dehydrogen 2e-23
d1ez0a_504 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 8e-23
d1ad3a_446 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-22
d1ky8a_499 c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3 6e-21
d1euha_474 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 4e-20
d1o20a_414 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 1e-10
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: 1-pyrroline-5-carboxylate dehydrogenase
species: Thermus thermophilus [TaxId: 274]
 Score =  128 bits (321), Expect = 3e-36
 Identities = 51/138 (36%), Positives = 73/138 (52%), Gaps = 10/138 (7%)

Query: 3   EIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDS 62
           +++ GG+  E  GYFI PT+     P  +I  EEIFGPVL++     KD  + L++  D 
Sbjct: 384 QLVLGGKRLEGEGYFIAPTVFTEVPPKARIAQEEIFGPVLSVIRV--KDFAEALEVAND- 440

Query: 63  TPYALTGAVFAEDESFQKRCLDDLKYAAGNYYINDKSTGSVVGQQPFGG-----TNDKAG 117
           TPY LTG V++      +    +     GN Y N K TG++VG QPFGG     TN K G
Sbjct: 441 TPYGLTGGVYSRKREHLEWARREFH--VGNLYFNRKITGALVGVQPFGGFKLSGTNAKTG 498

Query: 118 GPHYVLRWATPQSIKETF 135
              Y+  +   +++ E F
Sbjct: 499 ALDYLRLFLEMKAVAERF 516


>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Length = 474 Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Length = 504 Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 499 Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Length = 474 Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
d1o04a_494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 99.97
d1ad3a_446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 99.97
d1bxsa_494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 99.97
d1uzba_516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 99.97
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 99.97
d1a4sa_503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 99.97
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 99.94
d1ky8a_499 Non-phosphorylating glyceraldehyde-3-phosphate deh 99.94
d1ez0a_504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 99.85
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 99.84
d1vlua_436 Gamma-glutamyl phosphate reductase {Baker's yeast 99.52
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Human (Homo sapiens), mitochondrial [TaxId: 9606]
Probab=99.97  E-value=1.6e-31  Score=221.70  Aligned_cols=130  Identities=28%  Similarity=0.480  Sum_probs=118.4

Q ss_pred             eEEEECCcccCCCCceEecEEEEeCCCCCcccccccccceEEEEEcCCCCHHHHHHHHhhCCCCccEEEEEcCCHHHHHH
Q psy1961           2 SEIIGGGQYDESCGYFIQPTIVQTKDPLEKIMTEEIFGPVLTIFVYPDKDLDKTLKIVTDSTPYALTGAVFAEDESFQKR   81 (147)
Q Consensus         2 a~v~~GG~~~~~~g~~~~Ptvl~~v~~~~~i~~eE~FGPvl~v~~~~~~~~~eai~~a~n~~~~gL~~~vft~d~~~~~~   81 (147)
                      |++++||....+.|+|++|||+.+++++|++++||+||||++|++|+|  +||||+++ |+++|||+++|||+|.+++.+
T Consensus       359 a~vl~gg~~~~~~g~~~~Ptvl~~~~~~~~~~~eE~FGPvl~v~~~~~--~~eai~~a-n~~~~gL~a~i~s~d~~~~~~  435 (494)
T d1o04a_         359 AKLLCGGGIAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKT--IEEVVGRA-NNSTYGLAAAVFTKDLDKANY  435 (494)
T ss_dssp             CEEEECCSBCCSSSSCBCCEEEESCCTTSHHHHSCCCSSEEEEEEECC--HHHHHHHH-HCSSCCSEEEEECSBHHHHHH
T ss_pred             CEEEECCCcCCCCCceEcCEEEeCCCCCCHHHhccccCceEEEEEeCC--HHHHHHHH-hCCCCCCeEEEEeCCHHHHHH
Confidence            689999987767899999999999999999999999999999999998  79999999 999999999999999999999


Q ss_pred             HHhhccCceeEEEEcCCCCCCCCCCccccC----cCCCCChHHHHhhcceeceEEEecCCCC
Q psy1961          82 CLDDLKYAAGNYYINDKSTGSVVGQQPFGG----TNDKAGGPHYVLRWATPQSIKETFVPLT  139 (147)
Q Consensus        82 ~~~~~~~~~G~v~iN~~~~~~~~~~~pfGG----~~g~~~g~~~~~~f~~~k~v~~~~~~~~  139 (147)
                      +++.+  ++|.|+||+....  .+.+||||    |.|+.+|.+++++|++.|+|+.+ ||..
T Consensus       436 ~~~~l--~~G~v~iN~~~~~--~~~~PfGG~~~SG~G~~~g~~~~~~ft~~k~v~~~-~p~k  492 (494)
T d1o04a_         436 LSQAL--QAGTVWVNCYDVF--GAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVK-VPQK  492 (494)
T ss_dssp             HHHHC--CSSEEEESCSSCC--CTTSCBCCSGGGEESCBSTGGGGGGGEEEEEEEEE-CSCC
T ss_pred             HHHhC--CeeEEEEcCCCCC--CCCCCcCCcccccCCchhHHHHHHHhcCeEEEEEe-CCCC
Confidence            99986  9999999987653  36799999    67888999999999999999876 5544



>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure