Diaphorina citri psyllid: psy1962


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MLDKLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDERGERVKESSDLEDLAFIARNTLRHLSS
ccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEcccccccccEEECcCECccccHHHHHHHHHHcc
MLDKLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDERGERVKESSDLEDLAFIARN**R****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDKLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDERGERVKESSDLEDLAFIARNTLRHLSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial Irreversible conversion of delta-1-pyrroline-5-carboxylate (P5C), derived either from proline or ornithine, to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles.confidentQ54RA2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IWJ, chain A
Confidence level:very confident
Coverage over the Query: 2-73
View the alignment between query and template
View the model in PyMOL