Psyllid ID: psy1962


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MLDKLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDERGERVKESSDLEDLAFIARNTLRHLSS
ccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEcccccccccEEEEcEEEccccHHHHHHHHHHcc
cccHEEcccHcHcHHcccHHccHHHHHHHHHHHHHHHcccccEEEEEcccccccEEEEcccccccHHHHHHHHHHHHcc
mldklkigdveytdsfagavidKKAFDRITGYIKhaksspnleiigggqydergervkessdleDLAFIARNTLRHLSS
mldklkigdveytdsfagavidkKAFDRITGYikhaksspnleiiggGQYDERGERVkessdledlafiarntlrhlss
MLDKLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDERGERVKESSDLEDLAFIARNTLRHLSS
*****KIGDVEYTDSFAGAVIDKKAFDRITGYIKHAK***NLEIIG*********************F***********
MLDKLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDERGERVKESSDLEDLAFIARN**R****
MLDKLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDER********DLEDLAFIARNTLRHLSS
*LDKLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDERGERVKESSDLEDLAFIARNTLRHL**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiii
iiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDKLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDERGERVKESSDLEDLAFIARNTLRHLSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query79 2.2.26 [Sep-21-2011]
Q7SY23 556 Delta-1-pyrroline-5-carbo yes N/A 0.772 0.109 0.451 4e-08
Q54RA2 558 Delta-1-pyrroline-5-carbo yes N/A 0.594 0.084 0.510 6e-07
Q8CHT0 562 Delta-1-pyrroline-5-carbo yes N/A 0.620 0.087 0.5 8e-07
P0C2X9 563 Delta-1-pyrroline-5-carbo yes N/A 0.620 0.087 0.48 3e-06
P30038 563 Delta-1-pyrroline-5-carbo yes N/A 0.620 0.087 0.46 5e-06
A7YWE4 563 Delta-1-pyrroline-5-carbo yes N/A 0.645 0.090 0.442 3e-05
P07275 575 Delta-1-pyrroline-5-carbo yes N/A 0.468 0.064 0.486 0.0008
>sp|Q7SY23|AL4A1_DANRE Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Danio rerio GN=aldh4a1 PE=2 SV=1 Back     alignment and function desciption
 Score = 56.6 bits (135), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 43/62 (69%), Gaps = 1/62 (1%)

Query: 4   KLKIGD-VEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDERGERVKESSD 62
           ++K+GD VE   +F  AVID K+F RI G+++HA+SSP+L+II GG  D++     E + 
Sbjct: 367 QIKVGDPVEDFSTFFSAVIDDKSFSRIKGWLEHARSSPHLKIIAGGNCDDKKGYFVEPTI 426

Query: 63  LE 64
           +E
Sbjct: 427 IE 428




Irreversible conversion of delta-1-pyrroline-5-carboxylate (P5C), derived either from proline or ornithine, to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles.
Danio rerio (taxid: 7955)
EC: 1EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 2
>sp|Q54RA2|AL4A1_DICDI Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0283293 PE=3 SV=1 Back     alignment and function description
>sp|Q8CHT0|AL4A1_MOUSE Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Mus musculus GN=Aldh4a1 PE=1 SV=3 Back     alignment and function description
>sp|P0C2X9|AL4A1_RAT Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Aldh4a1 PE=1 SV=1 Back     alignment and function description
>sp|P30038|AL4A1_HUMAN Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Homo sapiens GN=ALDH4A1 PE=1 SV=3 Back     alignment and function description
>sp|A7YWE4|AL4A1_BOVIN Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Bos taurus GN=ALDH4A1 PE=2 SV=1 Back     alignment and function description
>sp|P07275|PUT2_YEAST Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
328698360 535 PREDICTED: delta-1-pyrroline-5-carboxyla 0.620 0.091 0.795 5e-14
383847741 568 PREDICTED: delta-1-pyrroline-5-carboxyla 0.658 0.091 0.716 9e-13
350399488 568 PREDICTED: delta-1-pyrroline-5-carboxyla 0.632 0.088 0.7 2e-12
195440458 569 GK12188 [Drosophila willistoni] gi|19416 0.784 0.108 0.597 6e-12
242004871 528 delta-1-pyrroline-5-carboxylate dehydrog 0.658 0.098 0.653 6e-12
340728537 568 PREDICTED: LOW QUALITY PROTEIN: delta-1- 0.632 0.088 0.66 1e-11
194876019 574 GG13195 [Drosophila erecta] gi|190655482 0.734 0.101 0.627 2e-11
195161149 574 GL25324 [Drosophila persimilis] gi|19411 0.658 0.090 0.679 2e-11
125979097 574 GA20135 [Drosophila pseudoobscura pseudo 0.658 0.090 0.679 2e-11
195552912 574 GD17558 [Drosophila simulans] gi|1942021 0.645 0.088 0.692 2e-11
>gi|328698360|ref|XP_001952392.2| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 81.6 bits (200), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 39/49 (79%), Positives = 42/49 (85%)

Query: 3   DKLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYD 51
           +KLKIGDV   DSFA AVID KAF+RITGYI+HAK S NLEIIGGGQYD
Sbjct: 380 NKLKIGDVNEFDSFASAVIDDKAFNRITGYIEHAKKSQNLEIIGGGQYD 428




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383847741|ref|XP_003699511.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350399488|ref|XP_003485543.1| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|195440458|ref|XP_002068059.1| GK12188 [Drosophila willistoni] gi|194164144|gb|EDW79045.1| GK12188 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|242004871|ref|XP_002423300.1| delta-1-pyrroline-5-carboxylate dehydrogenase, putative [Pediculus humanus corporis] gi|212506302|gb|EEB10562.1| delta-1-pyrroline-5-carboxylate dehydrogenase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340728537|ref|XP_003402578.1| PREDICTED: LOW QUALITY PROTEIN: delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|194876019|ref|XP_001973699.1| GG13195 [Drosophila erecta] gi|190655482|gb|EDV52725.1| GG13195 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195161149|ref|XP_002021432.1| GL25324 [Drosophila persimilis] gi|194118545|gb|EDW40588.1| GL25324 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|125979097|ref|XP_001353581.1| GA20135 [Drosophila pseudoobscura pseudoobscura] gi|54642345|gb|EAL31094.1| GA20135 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195552912|ref|XP_002076564.1| GD17558 [Drosophila simulans] gi|194202175|gb|EDX15751.1| GD17558 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query79
FB|FBgn0037138 574 P5CDh1 "delta-1-Pyrroline-5-ca 0.645 0.088 0.692 1.7e-12
ZFIN|ZDB-GENE-040426-1179 556 aldh4a1 "aldehyde dehydrogenas 0.632 0.089 0.509 5.2e-08
UNIPROTKB|E1C8Z8 551 ALDH4A1 "Uncharacterized prote 0.620 0.088 0.5 1e-06
DICTYBASE|DDB_G0283293 558 DDB_G0283293 "putative delta-1 0.594 0.084 0.510 1.3e-06
MGI|MGI:2443883 562 Aldh4a1 "aldehyde dehydrogenas 0.620 0.087 0.5 1.3e-06
UNIPROTKB|I3LNB4 512 ALDH4A1 "Uncharacterized prote 0.620 0.095 0.48 1.5e-06
UNIPROTKB|F1LQ99 543 Aldh4a1 "Delta-1-pyrroline-5-c 0.620 0.090 0.48 4.3e-06
RGD|1624206 563 Aldh4a1 "aldehyde dehydrogenas 0.620 0.087 0.48 4.6e-06
UNIPROTKB|P0C2X9 563 Aldh4a1 "Delta-1-pyrroline-5-c 0.620 0.087 0.48 4.6e-06
UNIPROTKB|J9P2L3 564 TAS1R2 "Taste receptor type 1 0.620 0.086 0.46 4.6e-06
FB|FBgn0037138 P5CDh1 "delta-1-Pyrroline-5-carboxylate dehydrogenase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 176 (67.0 bits), Expect = 1.7e-12, P = 1.7e-12
 Identities = 36/52 (69%), Positives = 40/52 (76%)

Query:     4 KLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQY-DERG 54
             KLKIGDV+   SF  AVID KAF RITGYI+HAK SPNLEI+ GG Y D +G
Sbjct:   385 KLKIGDVQDFSSFTSAVIDDKAFKRITGYIEHAKKSPNLEILAGGTYSDSKG 436




GO:0003842 "1-pyrroline-5-carboxylate dehydrogenase activity" evidence=ISS
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0006560 "proline metabolic process" evidence=ISS;IMP
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006561 "proline biosynthetic process" evidence=IEA
GO:0007005 "mitochondrion organization" evidence=IMP
GO:0005739 "mitochondrion" evidence=IDA
ZFIN|ZDB-GENE-040426-1179 aldh4a1 "aldehyde dehydrogenase 4 family, member A1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C8Z8 ALDH4A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0283293 DDB_G0283293 "putative delta-1-pyrroline-5-carboxylate dehydrogenase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
MGI|MGI:2443883 Aldh4a1 "aldehyde dehydrogenase 4 family, member A1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3LNB4 ALDH4A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQ99 Aldh4a1 "Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1624206 Aldh4a1 "aldehyde dehydrogenase 4 family, member A1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P0C2X9 Aldh4a1 "Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P2L3 TAS1R2 "Taste receptor type 1 member 2" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q54RA2AL4A1_DICDI1, ., 5, ., 1, ., 1, 20.51060.59490.0842yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
cd07123 522 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-ca 4e-20
TIGR01236 532 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carb 4e-13
cd07091476 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH 8e-07
cd07083500 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent 1e-06
cd07124512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 1e-06
cd07108457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 2e-06
pfam00171459 pfam00171, Aldedh, Aldehyde dehydrogenase family 7e-06
PRK03137514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 1e-05
TIGR01237511 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carb 4e-05
cd07090 457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 2e-04
cd07143481 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans al 3e-04
COG1012472 COG1012, PutA, NAD-dependent aldehyde dehydrogenas 7e-04
cd07086478 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha 0.001
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 0.002
cd07142476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 0.003
cd07117475 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylo 0.004
>gnl|CDD|143441 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
 Score = 81.9 bits (203), Expect = 4e-20
 Identities = 30/51 (58%), Positives = 37/51 (72%)

Query: 1   MLDKLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYD 51
            L ++K+GD +   +F GAVID+KAFDRI GYI HAKS P  EII GG+ D
Sbjct: 341 ELKEIKMGDPDDFSNFMGAVIDEKAFDRIKGYIDHAKSDPEAEIIAGGKCD 391


Delta(1)-pyrroline-5-carboxylate dehydrogenase (EC=1.5.1.12 ), families 4 and 17: a proline catabolic enzyme of the aldehyde dehydrogenase (ALDH) protein superfamily. Delta(1)-pyrroline-5-carboxylate dehydrogenase (P5CDH), also known as ALDH4A1 in humans, is a mitochondrial homodimer involved in proline degradation and catalyzes the NAD + -dependent conversion of P5C to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes. Also included in this CD is the Aldh17 Drosophila melanogaster (Q9VUC0) P5CDH and similar sequences. Length = 522

>gnl|CDD|233324 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>gnl|CDD|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>gnl|CDD|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|200087 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|143461 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>gnl|CDD|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>gnl|CDD|143435 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 79
KOG2450|consensus501 99.68
PRK11241482 gabD succinate-semialdehyde dehydrogenase I; Provi 99.61
cd07140486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 99.6
TIGR01780448 SSADH succinate-semialdehyde dehydrogenase. SSADH 99.59
KOG2451|consensus503 99.57
cd07123 522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 99.57
PLN02766501 coniferyl-aldehyde dehydrogenase 99.56
TIGR01236 533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 99.54
cd07141481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 99.54
PLN02419 604 methylmalonate-semialdehyde dehydrogenase [acylati 99.54
cd07113477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 99.53
PRK09406457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 99.53
PRK10090409 aldehyde dehydrogenase A; Provisional 99.52
TIGR03374472 ABALDH 1-pyrroline dehydrogenase. Members of this 99.52
COG1012472 PutA NAD-dependent aldehyde dehydrogenases [Energy 99.52
TIGR03216481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 99.51
cd07106446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 99.5
cd07559480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 99.5
PLN02278498 succinic semialdehyde dehydrogenase 99.5
PLN02466538 aldehyde dehydrogenase family 2 member 99.5
cd07099453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 99.49
cd07142476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 99.49
TIGR02278 663 PaaN-DH phenylacetic acid degradation protein paaN 99.49
PRK13473475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 99.49
cd07085478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 99.48
PRK13968462 putative succinate semialdehyde dehydrogenase; Pro 99.48
cd07130474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 99.48
cd07097473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 99.47
cd07117475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 99.47
cd07091476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 99.47
PLN02315 508 aldehyde dehydrogenase family 7 member 99.47
cd07100429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 99.47
cd07143481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 99.47
cd07107456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 99.46
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 99.46
cd07110456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 99.45
TIGR03250472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 99.45
PRK13252488 betaine aldehyde dehydrogenase; Provisional 99.45
cd07088468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 99.45
cd07115453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 99.45
PLN02174 484 aldehyde dehydrogenase family 3 member H1 99.45
TIGR02299 488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 99.44
PLN02467 503 betaine aldehyde dehydrogenase 99.44
cd07118454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 99.44
PRK09407 524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 99.44
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 99.44
cd07092450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 99.43
cd07119 482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 99.43
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 99.43
cd07089459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 99.43
cd07120455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 99.42
cd07112462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 99.42
cd07139471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 99.41
cd07114457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 99.41
cd07148455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 99.41
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 99.4
cd07083500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 99.4
cd07111480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 99.4
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 99.4
cd07145456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 99.4
cd07138466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 99.4
cd07108457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 99.39
cd07090457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 99.39
cd07095431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 99.39
TIGR01804467 BADH glycine betaine aldehyde dehydrogenase. Betai 99.39
PF00171462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 99.39
cd07102452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 99.39
cd07103451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 99.38
cd07144484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 99.38
cd07094453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 99.38
cd07124512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 99.38
PRK09457 487 astD succinylglutamic semialdehyde dehydrogenase; 99.38
TIGR01237511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 99.38
cd07116479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 99.38
cd07151465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 99.37
cd07150451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 99.36
PRK11563 675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 99.36
cd07146451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 99.35
cd07152443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 99.35
KOG2455|consensus 561 99.35
cd07128 513 ALDH_MaoC-N N-terminal domain of the monoamine oxi 99.33
cd07147452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 99.33
PRK03137514 1-pyrroline-5-carboxylate dehydrogenase; Provision 99.32
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 99.31
cd07109454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 99.31
cd07082473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 99.3
cd07104431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 99.3
KOG2452|consensus881 99.3
PLN02203 484 aldehyde dehydrogenase 99.3
TIGR03240 484 arg_catab_astD succinylglutamic semialdehyde dehyd 99.3
cd07093455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 99.29
cd07149453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 99.28
PLN00412 496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 99.28
cd07134433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 99.27
cd07137432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 99.27
PRK11903 521 aldehyde dehydrogenase; Provisional 99.26
KOG2454|consensus 583 99.23
KOG2453|consensus 507 99.23
cd07133434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 99.22
cd07125 518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 99.21
cd07135436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 99.2
cd07078432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 99.19
TIGR01238500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 99.14
PRK11904 1038 bifunctional proline dehydrogenase/pyrroline-5-car 99.11
cd07105432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 99.09
PRK11809 1318 putA trifunctional transcriptional regulator/proli 99.08
cd07136 449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 99.07
PRK11905 1208 bifunctional proline dehydrogenase/pyrroline-5-car 99.0
PTZ00381 493 aldehyde dehydrogenase family protein; Provisional 98.99
cd07132 443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 98.98
cd07087426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 98.73
cd07127 549 ALDH_PAD-PaaZ Phenylacetic acid degradation protei 98.72
KOG2456|consensus 477 98.67
cd07126489 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de 98.65
TIGR02288 551 PaaN_2 phenylacetic acid degradation protein paaN. 98.62
cd07084 442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 98.42
COG4230 769 Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene 98.25
cd07129 454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 97.94
TIGR02518 488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 97.71
cd07081 439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 97.67
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 97.11
PRK15398 465 aldehyde dehydrogenase EutE; Provisional 96.5
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 95.52
KOG2449|consensus157 95.04
cd07122436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 93.57
>KOG2450|consensus Back     alignment and domain information
Probab=99.68  E-value=7.9e-17  Score=114.44  Aligned_cols=70  Identities=23%  Similarity=0.303  Sum_probs=65.0

Q ss_pred             ceecCCCCCCCCcccccCCHHHHHHHHHHHHHHhhCCCcEEEeCCcccCCCCCeEeeeEEecCCCchhhcc
Q psy1962           4 KLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDERGERVKESSDLEDLAFIARNTL   74 (79)
Q Consensus         4 ~l~~Gdp~~~~~~~Gpli~~~~~~rv~~~i~~a~~~~ga~i~~gg~~~~~~g~~v~Ptil~~v~~~~~~~~   74 (79)
                      ++++|||.++.++.||+||+.|++||.+||+.++++ ||++++||......||||.||||.+|.++||+-.
T Consensus       329 ~~kvGdP~~~~~~qG~~i~~~q~ekI~~yi~~~k~e-Ga~l~~gG~~~g~~Gyfi~Ptv~~~v~~~m~i~~  398 (501)
T KOG2450|consen  329 KLKVGDPFDEGTEQGPQISKTQYEKILGYIESGKKE-GATLLCGGVRLGDKGYFIKPTVFTNVTDDMRIAK  398 (501)
T ss_pred             ccccCCCCCcccccccccCHHHHHHHHHHHHHHHhc-CCEEEecCcccCCCceEECCeeccCCChhhhhhH
Confidence            489999999999999999999999999999999999 8999999976556899999999999999999753



>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>KOG2451|consensus Back     alignment and domain information
>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>KOG2455|consensus Back     alignment and domain information
>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>KOG2452|consensus Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>PRK11903 aldehyde dehydrogenase; Provisional Back     alignment and domain information
>KOG2454|consensus Back     alignment and domain information
>KOG2453|consensus Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>cd07127 ALDH_PAD-PaaZ Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like Back     alignment and domain information
>KOG2456|consensus Back     alignment and domain information
>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>KOG2449|consensus Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
3v9j_A 563 Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylat 7e-08
3v9i_A 566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 4e-07
3v9h_A 566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 5e-07
3v9g_A 566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 5e-07
>pdb|3V9J|A Chain A, Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylate Dehydrogenase Complexed With Sulfate Ion Length = 563 Back     alignment and structure

Iteration: 1

Score = 52.4 bits (124), Expect = 7e-08, Method: Composition-based stats. Identities = 25/50 (50%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Query: 4 KLKIGD-VEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDE 52 ++K+GD E +F AVID KAF RI +++HA+SSP+L I+ GGQ +E Sbjct: 374 RIKVGDPAEDFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNE 423
>pdb|3V9I|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352l Length = 566 Back     alignment and structure
>pdb|3V9H|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352a Length = 566 Back     alignment and structure
>pdb|3V9G|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Length = 566 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query79
4e3x_A 563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 8e-16
3qan_A 538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 9e-11
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 1e-06
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 1e-06
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 2e-06
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 4e-06
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 5e-06
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 7e-06
4f9i_A 1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 2e-05
3haz_A 1001 Proline dehydrogenase; proline utilization A, PUTA 3e-05
3r31_A 517 BADH, betaine aldehyde dehydrogenase; structural g 4e-05
1a4s_A 503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 2e-04
2ve5_A 490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 2e-04
3ed6_A 520 Betaine aldehyde dehydrogenase; structural genomic 2e-04
3iwj_A 503 Putative aminoaldehyde dehydrogenase; rossmann fol 4e-04
3u4j_A 528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 4e-04
2d4e_A 515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 7e-04
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
 Score = 69.2 bits (170), Expect = 8e-16
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 1/52 (1%)

Query: 2   LDKLKIGD-VEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDE 52
             ++K+GD  E   +F  AVID KAF RI  +++HA+SSP+L I+ GGQ +E
Sbjct: 372 HSRIKVGDPAEDFGTFFSAVIDAKAFARIKKWLEHARSSPSLSILAGGQCNE 423


>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query79
2wme_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 99.6
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 99.59
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 99.59
3ros_A 484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 99.58
4e3x_A 563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 99.57
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 99.56
3rh9_A 506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 99.56
3iwj_A 503 Putative aminoaldehyde dehydrogenase; rossmann fol 99.56
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 99.56
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 99.56
3ed6_A 520 Betaine aldehyde dehydrogenase; structural genomic 99.56
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 99.55
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 99.55
3u4j_A 528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 99.54
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 99.54
3b4w_A 495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 99.54
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 99.53
3qan_A 538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 99.52
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 99.52
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 99.52
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 99.52
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 99.51
4e4g_A 521 Methylmalonate-semialdehyde dehydrogenase; structu 99.51
3k2w_A 497 Betaine-aldehyde dehydrogenase; structural genomic 99.5
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 99.49
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 99.48
3r31_A 517 BADH, betaine aldehyde dehydrogenase; structural g 99.48
3pqa_A 486 Lactaldehyde dehydrogenase; structural genomics, p 99.48
2d4e_A 515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 99.48
1uxt_A 501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 99.46
3r64_A 508 NAD dependent benzaldehyde dehydrogenase; structur 99.46
1t90_A 486 MMSDH, probable methylmalonate-semialdehyde dehydr 99.46
3prl_A 505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 99.46
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 99.46
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 99.46
4dng_A 485 Uncharacterized aldehyde dehydrogenase ALDY; struc 99.46
3ju8_A 490 Succinylglutamic semialdehyde dehydrogenase; alpha 99.45
2y53_A 534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 99.43
4h7n_A 474 Aldehyde dehydrogenase; structural genomics, PSI-b 99.43
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 99.43
4f9i_A 1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 99.39
3sza_A 469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 99.24
3haz_A 1001 Proline dehydrogenase; proline utilization A, PUTA 99.01
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 98.88
1ez0_A 510 ALDH, aldehyde dehydrogenase; nucleotide binding d 98.02
3v4c_A 528 Aldehyde dehydrogenase (NADP+); structural genomic 97.97
3my7_A 452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 97.11
3k9d_A 464 LMO1179 protein, aldehyde dehydrogenase; structura 96.95
>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
Probab=99.60  E-value=1.5e-15  Score=107.54  Aligned_cols=70  Identities=14%  Similarity=0.274  Sum_probs=63.1

Q ss_pred             CCceecCCCCCCCCcccccCCHHHHHHHHHHHHHHhhCCCcEEEeCCcccC----CCCCeEeeeEEecCCCchhh
Q psy1962           2 LDKLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDE----RGERVKESSDLEDLAFIARN   72 (79)
Q Consensus         2 ~~~l~~Gdp~~~~~~~Gpli~~~~~~rv~~~i~~a~~~~ga~i~~gg~~~~----~~g~~v~Ptil~~v~~~~~~   72 (79)
                      ++++++|||.+++++||||||++|++|+.++|++++++ |+++++||....    .+|+|++||||++++++|+.
T Consensus       310 ~~~l~vGdp~~~~~~~Gpli~~~~~~rv~~~i~~a~~~-Ga~v~~gG~~~~~~~~~~G~~~~Ptvl~~v~~~~~i  383 (490)
T 2wme_A          310 VQRIRLGDPQDENTNFGPLVSFPHMESVLGYIESGKAQ-KARLLCGGERVTDGAFGKGAYVAPTVFTDCRDDMTI  383 (490)
T ss_dssp             HHTCCBSCTTSTTCCBCCCSCHHHHHHHHHHHHHHHHT-TCEEEECCSBCCTTTGGGTTCBCCEEEESCCTTSHH
T ss_pred             HHhCcCCCCccccCccCCcCCHHHHHHHHHHHHHHHhc-CCEEEECCcccCcccccCCCccCCEEEEcCCCCChh
Confidence            35789999999999999999999999999999999998 899999987532    35899999999999999975



>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 79
d1bxsa_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-07
d1o04a_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 3e-07
d1a4sa_ 503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 5e-05
d1uzba_516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 1e-04
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Sheep (Ovis aries) [TaxId: 9940]
 Score = 44.2 bits (104), Expect = 1e-07
 Identities = 13/54 (24%), Positives = 22/54 (40%)

Query: 1   MLDKLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDERG 54
              K  +G+        G  IDK+ +++I   I+  K        GGG +  +G
Sbjct: 319 RAKKYVLGNPLTPGVSQGPQIDKEQYEKILDLIESGKKEGAKLECGGGPWGNKG 372


>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query79
d1bxsa_494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 99.55
d1o04a_494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 99.55
d1a4sa_503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 99.42
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 99.3
d1uzba_516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 99.27
d1ky8a_ 499 Non-phosphorylating glyceraldehyde-3-phosphate deh 98.66
d1ad3a_ 446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 98.44
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 97.69
d1ez0a_ 504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 92.65
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Sheep (Ovis aries) [TaxId: 9940]
Probab=99.55  E-value=4.6e-15  Score=102.94  Aligned_cols=70  Identities=19%  Similarity=0.201  Sum_probs=63.8

Q ss_pred             CCceecCCCCCCCCcccccCCHHHHHHHHHHHHHHhhCCCcEEEeCCcccCCCCCeEeeeEEecCCCchhh
Q psy1962           2 LDKLKIGDVEYTDSFAGAVIDKKAFDRITGYIKHAKSSPNLEIIGGGQYDERGERVKESSDLEDLAFIARN   72 (79)
Q Consensus         2 ~~~l~~Gdp~~~~~~~Gpli~~~~~~rv~~~i~~a~~~~ga~i~~gg~~~~~~g~~v~Ptil~~v~~~~~~   72 (79)
                      ++++++|+|.++++++|||||+++++|+.+++++++++ |+++++||......|+|++||||.+++++|+.
T Consensus       320 ~~~~~~g~~~~~~~~~gpli~~~~~~~~~~~i~~a~~~-Ga~~~~gg~~~~~~g~~~~Ptvl~~~~~~~~~  389 (494)
T d1bxsa_         320 AKKYVLGNPLTPGVSQGPQIDKEQYEKILDLIESGKKE-GAKLECGGGPWGNKGYFIQPTVFSDVTDDMRI  389 (494)
T ss_dssp             HTCCCBSCTTSTTCCBCCCSCHHHHHHHHHHHHHHHHT-TCEECSCCSEECSSSCEECCEEEESCCTTSHH
T ss_pred             hhheeeeccCCCCCcCCCcCCHHHHHHHHHHHHHHHHc-CCEEEeCCCccCCCceeEcCEEEeCCCCCcHH
Confidence            35789999999999999999999999999999999998 89999998765567999999999999999875



>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure