Diaphorina citri psyllid: psy1991

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360------

MMMCTQKLNSIGIQHCSIKHKQAHSSQFSSTLPTCLGLDKCPFPYILFCFLCCPQVWHDIETVMSGEGPPVFIDYTAASDLVQDIIPNVESSTSNTPVSNYYIDFNTSNNYKNKPPDQIVPNLLYSEIKKYEDVYKNEPLSAFVEYSVKSENSSNLSDEHKQTLSCNYNQYPSQHSIDSSSVNNYSSLYLSPVTPSNPEFYPENYQYHHYRDDYSLDIKYQPEYEHYRVNSSSHGNYNKLHIHPYYQTHHHTQIFQTPSITIKSSLLSKPKRRQNWSRRKIIMHTCSHNGCGKTYTKSSHLKAHLRTHTGEKPYQCGWKGCGWKFARSDELTRHFRKHTGDRPFQCTLCERAFSRSDHLSLHMKRH

ccccccccccccEEccccccccccccccccccccccccccccccCEEEEECccccccHHHHHHccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccEEccHHHHHHHHccccccccEEcccccccccccccHHHccccccccccccccccccccccccHHHHHHHHccc

********NSIGIQHCSI***********STLPTCLGLDKCPFPYILFCFLCCPQVWHDIETVMSGEGPPVFIDYTAASDLVQDIIPNVE*****TPVSNYYIDFNTSNNYKNKPPDQIVPNLLYSEIKKYEDVYKNEPLSAFVEY*****************************************LYLS*V****PEFYPENYQYHHYRDDYSLDIKYQPEYEHYRVNSSSHGNYNKLHIHPYYQTHHHTQIFQTPSITIKSSL********NWSRRKIIMHTCSHNGCGKTYTKSSHLKAHLRTHTGEKPYQCGWKGCGWKFARSDELTRHFRKHTGDRPFQCTLCERAFSRSDHLSLHM***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0050847 [BP]	progesterone receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0030522, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0030518, GO:0007154, GO:0050789, GO:0044699
GO:0043565 [MF]	sequence-specific DNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0008284 [BP]	positive regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0030033 [BP]	microvillus assembly	probable	GO:0022607, GO:0030030, GO:0030031, GO:0009987, GO:0032528, GO:0016043, GO:0044085, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0001525 [BP]	angiogenesis	probable	GO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0048646, GO:0048731, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0003700 [MF]	sequence-specific DNA binding transcription factor activity	probable	GO:0003674, GO:0001071
GO:0045893 [BP]	positive regulation of transcription, DNA-dependent	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0007566 [BP]	embryo implantation	probable	GO:0032502, GO:0044703, GO:0044702, GO:0000003, GO:0044707, GO:0044706, GO:0007565, GO:0022414, GO:0032501, GO:0008150, GO:0007275, GO:0044699, GO:0051704
GO:0008270 [MF]	zinc ion binding	probable	GO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:1901653 [BP]	cellular response to peptide	probable	GO:1901700, GO:1901701, GO:0051716, GO:0009719, GO:1901698, GO:0071417, GO:1901699, GO:0044763, GO:0010033, GO:0071495, GO:0071310, GO:1901652, GO:0008150, GO:0070887, GO:0050896, GO:0042221, GO:0009987, GO:0010243, GO:0044699
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0035914 [BP]	skeletal muscle cell differentiation	probable	GO:0030154, GO:0014706, GO:0051146, GO:0061061, GO:0007275, GO:0044699, GO:0007517, GO:0048869, GO:0007519, GO:0048513, GO:0032502, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GLI, chain A
Confidence level:very confident
Coverage over the Query: 231-366
View the alignment between query and template
View the model in PyMOL