Diaphorina citri psyllid: psy1999


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MTYLILKILLICLVAHNPTDSLSTSQLNSKKLLNKEKCTKIYPKKFVGYVPFGNRAAGNFTKVVPEEGLPMTVEQCVQTCCNDESCNIVFMYRAEGKINCFLVTKVPDYPPEANAGSDVILYLPNSNVTLNGNMSTDDHGLVSYEWTLRESLNQHKPVDMQKSKTPYLQLSNLELGE
ccHHHHHHHHHHHHHccccccccccccccHHccccccccccccccCCcccccccccccccCECcccccccccccccccEEcccccccEEEEEEccccEEEEEEcccccccccccccccEEEEccccEEEEEcccccccccEEEEEEEEcccccccccEECccccccEEEEccccccc
*TYLILKILLICLVAHNPTDSLSTSQLNSKKLLNKEKCTKIYPKKFVGYVPFGNRAAGNFTKVVPEEGLPMTVEQCVQTCCNDESCNIVFMYRAEGKINCFLVTKVPDYPPEANAGSDVILYLPNSNVTLNGNMSTDDHGLVSYEWTLR**************KTPYLQLSNL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTYLILKILLICLVAHNPTDSLSTSQLNSKKLLNKEKCTKIYPKKFVGYVPFGNRAAGNFTKVVPEEGLPMTVEQCVQTCCNDESCNIVFMYRAEGKINCFLVTKVPDYPPEANAGSDVILYLPNSNVTLNGNMSTDDHGLVSYEWTLRESLNQHKPVDMQKSKTPYLQLSNLELGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dyslexia-associated protein KIAA0319-like protein Possible role in axon guidance through interaction with RTN4R.confidentQ5RFR6
Dyslexia-associated protein KIAA0319-like protein Possible role in axon guidance through interaction with RTN4R.confidentQ8K135
Dyslexia-associated protein KIAA0319-like protein Possible role in axon guidance through interaction with RTN4R.confidentQ8IZA0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044433 [CC]cytoplasmic vesicle partprobableGO:0005737, GO:0005575, GO:0031982, GO:0031410, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E7M, chain A
Confidence level:confident
Coverage over the Query: 107-177
View the alignment between query and template
View the model in PyMOL
Template: 2E7M, chain A
Confidence level:confident
Coverage over the Query: 47-90
View the alignment between query and template
View the model in PyMOL