Diaphorina citri psyllid: psy2059

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNSQEYRREESRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVSTLFIILT
cccEEEcccccccHHHHHHHHHHHccccEEEEccccccccccHHHHHHcccccccEEEEcccccEEEEccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccc
MTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNSQEYRREESRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVSTLFIILT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTIDFYYVPGSAPCRAVQLAAAQIGVPLNLKHTDLMKGEHLTPEFLKLNPQHTVPYSQQTNSQEYRREESRAIIAYLAEQYGKDDSLYPKDPKARGIVNQRLYFDIGTLYQRFADYFVSTLFIILT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutathione S-transferase 1, isoform C Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has DDT dehydrochlorinase activity.confidentQ93112
Glutathione S-transferase 1-1 Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has DDT dehydrochlorinase activity.confidentP20432

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006749 [BP]glutathione metabolic processprobableGO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006575, GO:0043603, GO:0006082, GO:0006520, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0006790, GO:0019752, GO:0008152, GO:0043436, GO:0008150, GO:0006518, GO:0044281
GO:0004364 [MF]glutathione transferase activityprobableGO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048046 [CC]apoplastprobableGO:0005575, GO:0005576
GO:0043295 [MF]glutathione bindingprobableGO:1901681, GO:0043168, GO:0042277, GO:0072341, GO:1900750, GO:0031406, GO:0043167, GO:0003674, GO:0005488, GO:0033218, GO:0016597
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0018833 [MF]DDT-dehydrochlorinase activityprobableGO:0003824, GO:0016829, GO:0003674, GO:0016848
GO:0004602 [MF]glutathione peroxidase activityprobableGO:0016209, GO:0003824, GO:0003674, GO:0016684, GO:0004601, GO:0016491
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.18Transferred entry: 2.5.1.18.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VK9, chain A
Confidence level:very confident
Coverage over the Query: 1-122
View the alignment between query and template
View the model in PyMOL